KEGG   Streptococcus pneumoniae R6 (avirulent): spr1936Help
Entry
spr1936           CDS       T00060                                 

Gene name
tktC
Definition
transketolase C-terminal subunit
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:spr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spr01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:spr00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917936..1918868)
Genome map
AA seq 310 aa AA seqDB search
MMRSTKELRHVYRDFLLEANQSSSDIVVLEADLSSSMATHNLEKDFGDRYVNVGIMEAEM
VGLAAGLSIQGFRPYLHTFGPFSSRRVFDQLFISLGYAQLDATVIGSDAGVTAEMNGGTH
MPFEEIGLLRLIPKSIIFEATDDIQFREILNQTLDLKGLKYIRTIRKAPEAVYQGGEDFS
KGYIELRHGEDLVIVASGIMVAPSIRVADELSKLGYSVGVIDLFRIKPIPEQIKTMLSGK
TIFTVENHNQIGGIGSALCELFSDDGITKIHRMGVQERFGQVGKMDYLLNEYGLSESNIK
EKVLEIYNAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaagtacgaaagaattacggcatgtatatagagacttccttttagaggctaat
caaagttcttctgatatagtagtcttagaagccgatttgtcaagttcgatggctactcat
aatcttgaaaaggactttggagaccgttatgtgaatgttgggattatggaagcagaaatg
gtcggccttgcagcaggcttgtctattcaggggtttagaccttatcttcatacatttggt
cctttttcttcacgaagggtatttgatcaattatttatttctcttggatacgcacaattg
gatgccactgtgattggatcagatgcaggagtaactgcagaaatgaatggtgggacacat
atgccatttgaagaaattggcttgttacgtttaattcctaaatcaatcattttcgaagca
actgatgatatccaatttcgtgaaatattgaatcagacattagacttaaaaggactaaaa
tatattcgaacaattagaaaagctccagaggctgtatatcaaggtggagaagatttttct
aaaggctacattgagttaagacatggtgaagatcttgtaatcgttgcttctggcataatg
gttgctccaagtattcgagttgcagatgaactgtctaaattaggttattcagtaggtgtg
atagatttatttagaatcaaaccgataccagaacagataaaaacaatgttaagtggaaaa
actatatttactgtagaaaaccacaatcagataggtggaattggcagtgctttatgtgaa
ttattctctgatgatggaataacaaaaattcatcggatgggtgttcaagaaagatttggt
caagtagggaaaatggattatcttcttaatgagtatggtttgagtgaatcgaatataaaa
gagaaggttctagaaatttataatgcaagatag

DBGET integrated database retrieval system