KEGG   Streptococcus pneumoniae R6 (avirulent): spr1936Help
Entry
spr1936           CDS       T00060                                 

Gene name
tktC
Definition
transketolase C-terminal subunit
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    spr1936 (tktC)
   01230 Biosynthesis of amino acids
    spr1936 (tktC)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    spr1936 (tktC)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    spr1936 (tktC)
Enzymes [BR:spr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     spr1936 (tktC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1917936..1918868)
Genome map
AA seq 310 aa AA seqDB search
MMRSTKELRHVYRDFLLEANQSSSDIVVLEADLSSSMATHNLEKDFGDRYVNVGIMEAEM
VGLAAGLSIQGFRPYLHTFGPFSSRRVFDQLFISLGYAQLDATVIGSDAGVTAEMNGGTH
MPFEEIGLLRLIPKSIIFEATDDIQFREILNQTLDLKGLKYIRTIRKAPEAVYQGGEDFS
KGYIELRHGEDLVIVASGIMVAPSIRVADELSKLGYSVGVIDLFRIKPIPEQIKTMLSGK
TIFTVENHNQIGGIGSALCELFSDDGITKIHRMGVQERFGQVGKMDYLLNEYGLSESNIK
EKVLEIYNAR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaagtacgaaagaattacggcatgtatatagagacttccttttagaggctaat
caaagttcttctgatatagtagtcttagaagccgatttgtcaagttcgatggctactcat
aatcttgaaaaggactttggagaccgttatgtgaatgttgggattatggaagcagaaatg
gtcggccttgcagcaggcttgtctattcaggggtttagaccttatcttcatacatttggt
cctttttcttcacgaagggtatttgatcaattatttatttctcttggatacgcacaattg
gatgccactgtgattggatcagatgcaggagtaactgcagaaatgaatggtgggacacat
atgccatttgaagaaattggcttgttacgtttaattcctaaatcaatcattttcgaagca
actgatgatatccaatttcgtgaaatattgaatcagacattagacttaaaaggactaaaa
tatattcgaacaattagaaaagctccagaggctgtatatcaaggtggagaagatttttct
aaaggctacattgagttaagacatggtgaagatcttgtaatcgttgcttctggcataatg
gttgctccaagtattcgagttgcagatgaactgtctaaattaggttattcagtaggtgtg
atagatttatttagaatcaaaccgataccagaacagataaaaacaatgttaagtggaaaa
actatatttactgtagaaaaccacaatcagataggtggaattggcagtgctttatgtgaa
ttattctctgatgatggaataacaaaaattcatcggatgggtgttcaagaaagatttggt
caagtagggaaaatggattatcttcttaatgagtatggtttgagtgaatcgaatataaaa
gagaaggttctagaaatttataatgcaagatag

DBGET integrated database retrieval system