KEGG   Streptococcus pneumoniae R6 (avirulent): spr1949Help
Entry
spr1949           CDS       T00060                                 

Definition
glycosyl hydrolase-like protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    spr1949
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    spr1949
Enzymes [BR:spr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     spr1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929900..1931780)
Genome map
AA seq 626 aa AA seqDB search
MVRFTGLSPKQTQAIEVLKGHISLPDVEVAVTQSDQASISIQGEEGHYQLTYRKPHQLYR
ALSLLVTVLAEADKVEIEEQAAYEDLAYMVDCSRNAVLNVASAKQMIEVLALMGYSTFEL
YMEDTYQIEGQPYFGYFRGAYSAEELQEIEAYAQQFDMTFVPCIQTLAHLSAFVKWGVKE
VQELRDVEDILLIGEEKVYDLIDGMFATLSKLKTRKVNIGMDEAHLVGLGRYLILNGVVD
RSLLMCQHLERVLDIADKYGFHCQMWSDMFFKLMSADGQYDRDVKIPEETRVYLDRLKDR
VTLVYWDYYQDSEEKYNRNFRNHHKISHDLAFAGGAWKWIGFTPHNHFSRLVAIEANKAC
RANQIKEVIVTGWGDNGGETAQFSILPSLQIWAELSYRNDLDGLSAHFKTNTGLTVEDFM
QIDLANLLPDLPGNLSGINPNRYVFYQDILCPILDQHMTPEQDKPHFAQAAETLANIKEK
AGNYAYLFETQAQLNAILSSKVDVGRRIRQAYQADDKESLQQIARQELPELRSQIEDFHA
LFSHQWLKENKVFGLDTVDIRMGGLLQRIKRAESRIEVYLAGQLDRIDELEVEILPFTDF
YADKDFAATTANQWHTIATASTIYTT
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggtaagatttacaggacttagtcccaaacaaacgcaagctattgaggttttaaaaggt
catatttctctaccagatgtggaagtggctgtcactcagtctgaccaagcctctatctct
atccagggtgaggaaggtcactatcaattgacctaccgcaaacctcaccaactctatcgt
gccttatccttgttggtaacagttctagcagaagctgataaagtagagattgaggaacaa
gcagcttacgaagatttggcttacatggttgactgttctcgaaatgcggtgctgaatgtg
gcttctgccaagcagatgattgaggtcttggctctcatgggctactcaacctttgagctt
tacatggaagacacttaccagattgaagggcaaccttactttggctatttccgtggagct
tattcagcagaggagttgcaggaaatcgaagcctatgcccaacagtttgacatgaccttt
gtaccatgcatccagaccttggcccacctgtcagcctttgtcaaatggggtgtcaaggaa
gtgcaggagctccgtgatgtagaggacattcttctcattggcgaagaaaaggtttatgac
ctgattgatggcatgtttgccacgttgtctaaactgaagactcgcaaggtcaatatcggg
atggacgaagcccacttggttggtttgggacgctacctgattctgaacggtgttgtggat
cgtagtctcctcatgtgccaacacttggagcgcgtgctggatattgctgacaaatatggt
ttccactgccagatgtggagtgatatgttcttcaaactcatgtcagcggatggccagtac
gatcgtgatgtgaaaattccagaggaaactcgtgtctacctagaccgtctcaaagaccgt
gtgactctggtttactgggattattatcaggatagcgaggaaaaatacaaccgtaatttc
cgcaatcatcacaagattagccatgaccttgcatttgcagggggagcttggaagtggatt
ggctttacacctcacaaccattttagccgtctagtggctatcgaggctaataaagcctgc
cgtgccaatcagattaaagaagtcatcgtaacgggttggggagacaatggtggtgaaact
gcccagttctctatcctaccaagcttgcaaatctgggcagaactcagctatcgcaatgac
ctagatggtttgtctgcgcacttcaagaccaatactggtctaacggttgaggattttatg
cagattgaccttgccaacctcttaccagacctaccaggcaatctcagcggtatcaatccc
aaccgctatgttttttatcaggatattctttgtccgattcttgatcaacacatgacacct
gaacaggacaaaccgcacttcgctcaggctgctgagacgcttgctaacattaaagaaaaa
gctggaaactatgcctatctctttgaaactcaggcccagttgaatgctattttaagtagc
aaagtagatgtgggacgacgcattcgtcaggcctaccaagcggatgataaagaaagttta
caacaaatcgccagacaagaattaccagaacttagaagccaaattgaagacttccatgcc
ctctttagtcaccaatggctgaaagaaaacaaggtctttggtttggatacagttgacatc
cgtatgggcggactcttgcaacgcatcaaacgagcagaaagccgtatcgaggtttatctg
gctggtcagcttgaccgcatcgacgagctggaagttgaaatcctaccatttactgacttc
tacgcagacaaggatttcgcagcaactacagccaaccagtggcataccattgcgacagcg
tcgacgatttatacgacttaa

DBGET integrated database retrieval system