KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0038Help
Entry
SPs0038           CDS       T00119                                 

Definition
(GenBank) putative alcohol dehydrogenase I
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPs0038
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPs0038
  Lipid metabolism
   00071 Fatty acid degradation
    SPs0038
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPs0038
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPs0038
   00626 Naphthalene degradation
    SPs0038
Enzymes [BR:sps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPs0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
55745..56593
Genome map
AA seq 282 aa AA seqDB search
MGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDG
GMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGN
LAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVV
TAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAF
AFGAEGLVVPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttggggcacgaaggtattggtatagtagaagaaattggagaaggcgtaacatccttaaag
gttggtgatcgtgtctctattgcatggttctttgaaggatgtggtcattgcgaatactgt
actacaggacgtgagacactttgtcgtagtgttaaaaatgctggatacagtgttgatgga
ggaatgagtgaatatgcagtagtaacagctgattatgcagttaaagttccagaaggttta
gacccggctcaagcttcttccattacttgtgctggtgtaacaacttataaagctattaaa
gaggcaggtgctgctccaggccaatggattgttatctttggggcaggtggccttggaaat
ctggctgttcaatacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaat
aatgataaacttgagttagctaaagaagttggcgcagatattgtagttaacggcaaagaa
attgaagatgttccaggctatattcaagaaaaaaccggtggagcacatggtgttgtggta
acggctgtttctaaagttgcttttaaccaagcaattgatagtgtccgtgccggtgggaca
gttgtagccgtaggtcttccatcagaatacatggaactgtctatcgtaaaaactgtttta
gatggtatcaaagtggtcggatcacttgtagggacacgtaaagacttggaagaagccttt
gcctttggtgcagaaggtctggttgttccggttgtcgaaaaagttccagttgacactgct
ccagaagtctttgatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttc
atcagctaa

DBGET integrated database retrieval system