KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0166Help
Entry
SPs0166           CDS       T00119                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPs0166
   00052 Galactose metabolism
    SPs0166
   00500 Starch and sucrose metabolism
    SPs0166
   00520 Amino sugar and nucleotide sugar metabolism
    SPs0166
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPs0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183267..184169)
Genome map
AA seq 300 aa AA seqDB search
MMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGK
SKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTF
VGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQ
AKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAID
TLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttttta
cctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaa
tttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaa
tcgaaacgctccatagaagatcattttgattctaattttgaattagaatataatttacag
gctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatcttcac
tttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagaccttt
gttggcaatgaaccttttgttgtcatgctgggtgatgatctgatggatattacaaatcca
aatgtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaact
attgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcctcaa
gcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaa
gatgcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagt
attttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgat
accctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgtt
ggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtc
aaagatgacttgaaagcctacatcatccaactgggcaaagcactagagaaaacaaaacca
taa

DBGET integrated database retrieval system