KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0166Help
Entry
SPs0166           CDS       T00119                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPs0166
   00052 Galactose metabolism
    SPs0166
   00500 Starch and sucrose metabolism
    SPs0166
   00520 Amino sugar and nucleotide sugar metabolism
    SPs0166
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPs0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183267..184169)
Genome map
AA seq 300 aa AA seqDB search
MMTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGK
SKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTF
VGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQ
AKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAID
TLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTKP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ctgatgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgtttttta
cctgcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaa
tttatcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaa
tcgaaacgctccatagaagatcattttgattctaattttgaattagaatataatttacag
gctaaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatcttcac
tttattcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagaccttt
gttggcaatgaaccttttgttgtcatgctgggtgatgatctgatggatattacaaatcca
aatgtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaact
attgccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcctcaa
gcaaaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaa
gatgcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagt
attttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgat
accctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgtt
ggcgataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtc
aaagatgacttgaaagcctacatcatccaactgggcaaagcactagagaaaacaaaacca
taa

DBGET integrated database retrieval system