KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0177Help
Entry
SPs0177           CDS       T00119                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sps00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPs0177 (gltX)
Enzymes [BR:sps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SPs0177 (gltX)
Amino acid related enzymes [BR:sps01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SPs0177 (gltX)
Transfer RNA biogenesis [BR:sps03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPs0177 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194041..195486
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNESGIYKWADMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFSR
EQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETVYALCKPFLEEAGRLTEKAEK
LVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVSTVLQAFKAKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHIKNM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgttatgcaccaagtccaacagggcttttacatatcggg
aatgcccgcacagccctatttaattacctttatgcccgtcgtcacggaggtacttttatc
attcgtattgaagatactgaccgtaaacgtcatgttgaagatggtgaacgttctcaactt
gaaaacctaaaatggttaggaatggattgggatgaaagcccagaaacgcatgaaaattac
cgccagtctgaacgtctagcactttatcaacaatatattgatcaattgttagctgaagga
aaagcctataagtcttacgtgactgaggaagaattggcagcagagcgtgaacgccaagaa
gcagctggcgaaacgcctcgctatatcaatgaatttattggtatgtcagctgacgaaaaa
gctaagtacattgctgagcgtgaagcagcaggtatcgttccaacagtccgtcttgctgtt
aatgagtccggtatttacaaatgggctgacatggttaaaggcgatatcgagtttgaaggt
ggtaacatcggtggtgactgggttattcaaaagaaagatgggtacccaacttataacttt
gccgttgttgttgatgatcatgatatgcaaatttctcacgttatccgtggcgatgaccat
attgccaatacgccaaaacaattgatggtctatgaagctcttggctgggaagcgccagag
tttggtcatatgactcttatcatcaattctgaaacgggtaaaaaattatcaaaacgcgac
accaataccctccaattcattgaagattaccgcaaaaaaggttatatgcctgaagctgtc
tttaacttcatcgcccttcttggctggaatcctggcggagaagaggaaatcttctctcgt
gagcaactgattgccctttttgatgaaaatcgccttagcaagtcgccagctgcctttgac
cagaagaaaatggattggatgagcaatgagtatcttaaacatgcggattttgaaacagtt
tatgccctctgcaaacctttccttgaagaggcaggccgtttgacagaaaaagctgagaag
ctagtagaattatacaaacctcaattaaaatctgcagatgagattattccattgactgac
cttttcttttctgatttccctgaattaacagaagccgaaaaagaagtgatggcaggtgaa
acagtttcgacagtcttgcaagctttcaaggctaagttggaagctatgtcagatgaagac
ttcaaaccagaaaatattttcccacaaattaaggctgttcaaaaagaaacaggaatcaaa
gggaaaaacctctttatgcctattcgtattgcagtatctggtgaaatgcatggcccagaa
ttaccaaatacgatttatttattgggacgtgataaatccattgagcacatcaaaaacatg
ctataa

DBGET integrated database retrieval system