KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0682Help
Entry
SPs0682           CDS       T00119                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPs0682
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPs0682
   00052 Galactose metabolism
    SPs0682
   00500 Starch and sucrose metabolism
    SPs0682
   00520 Amino sugar and nucleotide sugar metabolism
    SPs0682
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPs0682
   00524 Butirosin and neomycin biosynthesis
    SPs0682
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPs0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
688539..689510
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgttggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcttatgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacatttttatggcagcagaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system