KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0682Help
Entry
SPs0682           CDS       T00119                                 

Definition
(GenBank) putative glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00010  Glycolysis / Gluconeogenesis
sps00052  Galactose metabolism
sps00500  Starch and sucrose metabolism
sps00520  Amino sugar and nucleotide sugar metabolism
sps00521  Streptomycin biosynthesis
sps01100  Metabolic pathways
sps01110  Biosynthesis of secondary metabolites
sps01120  Microbial metabolism in diverse environments
sps01130  Biosynthesis of antibiotics
sps01200  Carbon metabolism
Module
sps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPs0682
   00052 Galactose metabolism
    SPs0682
   00500 Starch and sucrose metabolism
    SPs0682
   00520 Amino sugar and nucleotide sugar metabolism
    SPs0682
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPs0682
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPs0682
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPs0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAC63777
Position
688539..689510
Genome map
AA seq 323 aa AA seqDB search
MSQKLLGIDLGGTTIKFGILTAAGEVQEKWAIETNILEGGKHIVPDIIASIKHRLDLYGL
SSADFVGIGMGSPGAVDRDTNTVTGAFNLNWKETQEVGSVVEKELGIPFAIDNDANVAAL
GERWVGAGENNPDVVFMTLGTGVGGGIIADGNLIHGVAGAGGEIGHMIVEPENGFACTCG
SHGCLETVASATGVVKVARLLAEAYEGDSAIKAAIDNGEGVTSKDIFMAAEAGDSFADSV
VEKVGYYLGLASANISNILNPDSVVIGGGVSAAGEFLRSRIEKYFVTFTFPQVRYSTKIK
IAELGNDAGIIGAASLARQFITK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaattactggggattgatttaggtggtaccaccattaaatttggaatttta
acagcagcaggagaagtccaagaaaaatgggcaattgagactaatattttagaaggaggc
aaacatattgtccctgatatcatcgcttccatcaaacatcgcttagacttgtatggtcta
agcagtgctgattttgtgggaattggtatgggatcaccaggagcggttgaccgtgatact
aatacagttactggggcattcaaccttaattggaaagaaacccaagaagtcggttccgtt
gttgaaaaagaattgggcattccttttgccattgacaatgatgccaatgtggctgccctt
ggtgaacgttgggtaggtgctggtgaaaataacccagatgtcgtcttcatgacacttgga
acaggtgttggtggaggcattattgctgatggtaacttgattcatggtgttgcaggagca
ggtggtgaaatcggccacatgattgttgagccagaaaatggctttgcttgtacttgtggc
tcacacggctgtttggaaacagtagcttcagcaacaggagttgtcaaagtggcacgttta
ctggcagaagcttatgaaggggattcagccatcaaagcagctattgacaatggtgaaggt
gttaccagtaaagacatttttatggcagcagaagcaggggattcctttgctgattctgtt
gtggaaaaggttggttactaccttggccttgcttcagcaaatatttccaatatcttgaat
ccagactcagtggttatcggtgggggtgtgtcagcagcaggagaatttctacgctcacgt
attgaaaaatactttgtgaccttcactttcccacaagtgaggtattcaactaaaattaag
attgcagagcttggcaatgatgctggaattatcggtgcagctagccttgctcgacaattt
atcacaaaatag

DBGET integrated database retrieval system