KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0775Help
Entry
SPs0775           CDS       T00119                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00010  Glycolysis / Gluconeogenesis
sps00260  Glycine, serine and threonine metabolism
sps00680  Methane metabolism
sps01100  Metabolic pathways
sps01110  Biosynthesis of secondary metabolites
sps01120  Microbial metabolism in diverse environments
sps01130  Biosynthesis of antibiotics
sps01200  Carbon metabolism
sps01230  Biosynthesis of amino acids
Module
sps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sps_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPs0775
  Energy metabolism
   00680 Methane metabolism
    SPs0775
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPs0775
Enzymes [BR:sps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPs0775
Membrane trafficking [BR:sps04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPs0775
Exosome [BR:sps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPs0775
  Exosomal proteins of melanoma cells
   SPs0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAC63870
UniProt: P0DD07
Position
763007..763702
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgatggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system