KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0775Help
Entry
SPs0775           CDS       T00119                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPs0775 (gpmA)
   01230 Biosynthesis of amino acids
    SPs0775 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPs0775 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPs0775 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPs0775 (gpmA)
Enzymes [BR:sps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPs0775 (gpmA)
Exosome [BR:sps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPs0775 (gpmA)
  Exosomal proteins of melanoma cells
   SPs0775 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
763007..763702
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgatggtaaaaacgtctttgttggc
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system