KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0779Help
Entry
SPs0779           CDS       T00119                                 

Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPs0779
DNA repair and recombination proteins [BR:sps03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SPs0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
766837..767331
Genome map
AA seq 164 aa AA seqDB search
MSNEDVNDFAKNLLAAKRELTYCSICGNLTDDDPCHICTDTSRDQTTILVVEDAKDVSAM
EKIQEYHGYYHVLHGLISPMNGVGPDDINLKSLITRLMDGKVSEVIVATNATADGEATSM
YISRVLKPAGIKVTRLARGLAVGSDIEYADEVTLLRAIENRTEL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaagatgtcaatgattttgctaaaaacttattagcagctaaaagagaactg
acctattgttcgatttgtggaaaccttaccgatgacgatccttgtcacatttgcacagac
acgagccgtgatcagacgaccattctggtagtagaagatgctaaagatgtttctgccatg
gaaaaaatccaagagtatcatggctattatcatgtgcttcacggcttgatttcgcctatg
aatggtgtggggccagatgacatcaaccttaaaagtttaattacccgtctaatggatggt
aaggtgagcgaagttatcgtagctaccaatgccacagcagatggggaagcaacgtccatg
tatatttcacgtgtcttgaaaccagccgggattaaggtaactcgtttggcaagaggtctc
gcagtaggttcagatattgagtatgctgatgaagtaacattattgagagctattgagaat
cgtactgaactttaa

DBGET integrated database retrieval system