KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0873Help
Entry
SPs0873           CDS       T00119                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPs0873
Enzymes [BR:sps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SPs0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873658..875151
Genome map
AA seq 497 aa AA seqDB search
MNKRASGILMHISSLPGKFGIGTFGKSAFEFVDFLAETKQTYWQILPLTTTSFGDSPYQS
FSAIAGNTHFIDFELLVDDELLEAADLCDITFGTNPEVVDYAQLFQVRRPLLEKAVRAFV
AEQENVCKLEAFETASSWLTDFAEFMALKEYFNNKALQDWDDETVIKRQEDSLNNYRELL
AKKITYHKVCQYFFYQQWSALKTYANHKGIEIIGDMPIYVSADSVEVWTMPELFKVDSDK
KPLFIAGVPADGFSEDGQLWGNPTYNWSAHEKSNFAWWIYRIQESFKLYDQLRIDHFKGF
SDFWEIPAGDKTARNGHWASAPGIALFSAVREALGELPIIAENLGYIDEKAEQLLASTGF
PGMKILEFGLFDITSQSIDLPHYYDRNCVAYTGTHDNEVVNGWYDNLSEEQVHFVNNYLH
KHADESITKAMLRTIFASVCDTAILCIQDLLDKDGKSRMNMPNTIGGNWQWRMLDGELNQ
DHKDYLIYLTDLYGRAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgtgcaagcggtatcttaatgcatattagttccctgcctgggaaatttggg
ataggcacttttggaaaatcagcttttgaatttgttgattttctagcagagacgaaacaa
acctattggcaaattctgcctttaacaacgacgagttttggagattctccttatcagtca
ttttcagctattgctgggaacacacatttcattgattttgaattgctagtagatgatgaa
cttttagaagcagcagatttgtgtgatattacattcggcacaaatcctgaagtagtagac
tatgctcagctttttcaagttagacgtccacttttagaaaaagcagtgagagcttttgtt
gctgaacaagaaaatgtgtgtaaattagaagcttttgaaacagcttctagctggttaact
gattttgctgaatttatggctttaaaagaatattttaacaataaagccttacaagattgg
gacgacgaaactgtcattaaacgccaagaagactcacttaataattaccgtgagttgctt
gcaaaaaagattacctatcataaagtctgtcaatacttcttttaccaacaatggtcagcc
ttgaaaacttacgctaaccataaagggatagaaattattggtgatatgcctatttatgtt
tctgcggacagtgtagaagtttggacgatgcctgagctatttaaagtagatagtgataaa
aagccattgtttattgcaggtgtaccagcagatggctttagtgaagatggtcagctgtgg
ggaaatccaacctacaattggtctgctcatgaaaagtctaattttgcatggtggatttat
cgtattcaagaaagtttcaaactatatgatcagctaagaatcgatcattttaaaggcttc
tcagatttttgggaaattcctgctggtgataaaactgctagaaatggccattgggcctca
gccccaggtatagcattattttctgcggttcgtgaggccttaggagagctccctatcatc
gcagaaaacttgggttatattgatgaaaaagcagagcagctattagcatcaacaggcttt
cctggcatgaagatattagaatttggtttatttgatataacgagtcaaagtatagattta
ccacattactatgaccgtaattgtgtcgcttacacagggactcatgataacgaggtggtt
aacggatggtatgacaatcttagtgaagaacaagtacactttgtaaataactatcttcac
aaacatgcagatgaaagtattacaaaagccatgctaagaacaatctttgcttctgtttgt
gatacagccattctttgcatccaagatttattagataaagatggtaagagtcgtatgaat
atgccaaatacaattggaggtaattggcaatggcgtatgcttgacggtgaattgaaccaa
gatcacaaagactaccttatttatttaacagatctttatggtcgcgcaagataa

DBGET integrated database retrieval system