KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0959Help
Entry
SPs0959           CDS       T00119                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPs0959 (folE)
Enzymes [BR:sps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPs0959 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944335..944943
Genome map
AA seq 202 aa AA seqDB search
MKMKRKKLMKRERLMSINKEKAEAAIYQFLEAIGENPNREGLLDTPKRVAKMYAEMFLGL
GKDPKEEFTAVFKEHHEDVVIVKDISFYSVCEHHLVPFYGKAHIAYLPSDGRVTGLSKLA
RAVEVASKRPQLQERLTSQIADALVEALNPKGTLVMVEAEHMCMTMRGIKKPGSKTITTT
ARGLYKESRAERQEVISLMTKD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaaaggaaaaaactaatgaaaagggaaagactaatgtctattaataaggaa
aaagcagaagcagccatttatcagtttttagaggctattggtgaaaatccaaatcgggaa
ggtcttcttgacacgcctaaacgggttgctaaaatgtatgcggagatgtttttgggactg
ggaaaagatcctaaagaggaatttacggctgtctttaaagaacaccatgaggatgtggtg
attgtcaaagacattagtttttattctgtatgtgagcaccacttagttcctttttatggc
aaggctcatatcgcttacttaccaagtgatggtcgagtaacaggtttgagtaaattagcg
cgagcagttgaagtagctagtaaacgacctcaactccaagagcgtttgacctctcaaata
gcggatgctttagttgaagccctcaatcctaaagggactttagttatggtagaagcagag
cacatgtgcatgaccatgcgaggcatcaaaaagccaggtagtaaaaccattaccaccact
gccagaggcttatataaggaaagtcgtgctgagaggcaagaagttatttctctaatgaca
aaagattag

DBGET integrated database retrieval system