KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0960Help
Entry
SPs0960           CDS       T00119                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944952..945752
Genome map
AA seq 266 aa AA seqDB search
MKIGKFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSATDEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFG
FAKSVQQNTELLKRLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaagtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggggctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctaccgatgaaattgacagggtggttcctgtgatcaag
gccatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggtcaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacagaatacggagttattaaaaagattggaccgcgtctgtcag
ttgggttatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggt
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

DBGET integrated database retrieval system