KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1274Help
Entry
SPs1274           CDS       T00119                                 

Definition
PTS system fructose-specific transporter subunit IIABC
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPs1274
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SPs1274
Enzymes [BR:sps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     SPs1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257227..1259173)
Genome map
AA seq 648 aa AA seqDB search
MKIQDLLRKDIMILDLQAISKEVAIDEMITKLVEKDIVHDFDVFKKSIMTREEQTSTGLG
DGIAMPHSKNIVVDKPAVLFAKSNKGVDYKALDGQPTDLFFMIAAPQGANDTHLAALAEL
SQYLLKDGFADKLRAAATPEAVIAVFDEASTAKEEVVAPTSGQDFIVAVTACPTGIAHTY
MAEEALKKQAAEMGVAIKVETNGASGVANRLTAEDIQRAKGVIVAADKAVEMDRFDGKQF
IARPVADGIKKSQELISLILNNEGNTYHAKNGKSETAVSTEKTSLGGAFYKHLMGGVSQM
LPFVIGGGIMIALAFLLDNMLGVPNDQLGGLGSYHEIAAIFMNIGGAAFSFMLPVLAGYI
AYSIAEKPGLVAGFVAGAIASNGLAFGKVPFAAGGEVSLGLTGVPSGFLGALVGGFLAGG
VILALRKLLAGLPRSLEGVKSILLYPLLGVLVTGFLMLFVNIPMAAINTALNDFLQGLSG
SSAVLMGLLVGGMMAVDMGGPVNKAAYVFGTGTLAATVANGGSVVMAAVMAGGMVPPLAV
FVATLLFKDKFTKEERESGLTNIVMGLSFITEGAIPFGAADPARAIPSFIAGSALTGALI
GLAGIKLMAPHGGIFVIALTSNPILYLVFVVIGALVSGILFGALRKKA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcaagatttattgagaaaagatattatgattctcgatttacaggctatttct
aaagaagttgccattgacgagatgattactaaattagttgaaaaagatattgtacatgat
tttgatgtctttaaaaagagtatcatgacacgtgaagaacaaacatcaacagggcttggt
gatgggattgccatgcctcattctaaaaatattgtagtagataaaccagcggtcttgttt
gcgaaatcaaataaaggtgtggattataaggctttagatggtcaaccaacggatctcttc
tttatgattgctgcgcctcaaggagcaaatgatactcacttggctgcactagcagaatta
tcacaataccttttgaaagacggctttgctgataaacttcgtgctgcagcgacaccagaa
gcagtcattgctgtttttgatgaagcgtcaacagctaaagaagaagtggttgctccaaca
agtggtcaagactttatcgttgctgttacagcttgtccgacaggaattgctcacacttat
atggcagaagaggctttgaaaaaacaagctgcagaaatgggagtagctattaaagttgaa
acaaacggtgcttctggtgtggctaatcgtttaaccgctgaagatattcagagagctaaa
ggagttattgttgcagctgataaagcggttgaaatggaccgttttgatggtaaacaattc
attgctcgccctgttgcagatggtatcaagaaaagtcaggaattgatttctttgatttta
aacaatgaaggaaacacttatcatgctaaaaatggaaaatctgaaacagcagtatcaact
gagaaaacaagtttaggcggtgctttctataaacacttgatgggcggtgtctcacaaatg
ttgccatttgttattggtggcgggattatgattgctctagcatttttattggataacatg
cttggtgtgccaaatgatcagcttggaggtcttggatcctatcatgaaatagcagctatt
tttatgaacattggtggagcagccttttctttcatgttaccagtactagcaggttatatc
gcttattctattgctgaaaaaccgggcttagtagctggttttgtggcaggtgccattgcc
tcaaatggtcttgcttttggtaaggtaccatttgcagcaggaggagaagtgagcttgggc
ttaacgggcgtgccatcaggtttccttggggcgcttgtgggtggtttccttgccggtggt
gttattcttgcccttcgtaaattgttggcaggcctaccacgttctctagaaggggttaaa
tctatcctcctttacccattacttggcgtccttgtcactggtttcttgatgctttttgtc
aatattccaatggcagctattaacacagcccttaatgatttcttacaaggtctttcagga
agctctgctgtccttatgggacttcttgttggtggaatgatggctgttgacatgggtggt
cctgttaataaggcagcttatgtttttggtacaggaactttagcagctactgtggcaaat
ggtggttcggtcgttatggccgctgttatggcaggtggtatggtacctcctcttgctgtt
tttgtagccactctcttgtttaaagataaatttaccaaagaagaacgtgaatcaggcttg
acaaatattgttatgggactttcattcatcaccgaaggagcaattccgtttggtgcagct
gacccagcacgtgcgattcctagctttatcgcaggttctgccttgacaggagctcttatt
ggtttggctggtattaaattaatggcgccacatggtggtatcttcgtaatcgctttaaca
agcaatccaatcttatatcttgtctttgttgtgattggcgcccttgtatcaggtatctta
tttggcgctcttcgcaaaaaagcctaa

DBGET integrated database retrieval system