KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1352Help
Entry
SPs1352           CDS       T00119                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPs1352
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPs1352
Enzymes [BR:sps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SPs1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1342943..1344214)
Genome map
AA seq 423 aa AA seqDB search
MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRNVPILSDVFTMNNVVR
GLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGVTSLHGVEHDVVQDRIEAG
TFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEEYGIRVQANTPKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLEEMRRMGLQSEILRETAMIHG
GRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHLDRGYYQFHEKLAKLGATISRS
SEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaataatcattgaaggtggtcaaacacgcttagaaggagaagttgttattgag
ggtgctaaaaacgcagttcttcctttactggcagcatctattttaccttcaaaaggaaaa
acaattcttagaaatgttcctattctatctgatgtttttaccatgaataacgtggtacgt
ggtttagatattcgtgttgattttaatgaagcagctaacgaaatcacagttgatgcctca
ggacacattttagatgaagccccttacgagtacgtgagccaaatgcgtgcctctattgtt
gttttaggaccaattttggcacgtaatggccacgcaaaagtatcaatgcctggaggctgt
acgattggcagtaggcctattaatttgcacttaaaaggattagaggctatgggggcaacg
attactcaaaaaggtggagatattaccgctcaagcagatcgactgcaaggtgccatgatt
tatatggacttcccatctgtaggagctacccaaaacttgatgatggctgccactttagct
gatggtgtgaccactattgaaaatgctgctcgtgagcctgaaattgttgatttagctcaa
tttttgaataaaatgggagctagaattcgtggtgctggaacagagacgttaacgataaca
ggcgtcacaagtcttcatggggtggagcacgatgtggttcaagaccgtattgaagcaggt
acttttatggttgcagcggcgatgacttcaggcaatgttttgattagagatgctgtttgg
gaacataatcgtccattgatttcaaaattaatggaaatgggtgtttctgtaacagaagaa
gaatatggtattcgcgttcaagcaaacacgccaaagctcaaacctgtaacggttaaaacc
ttgcctcatccaggttttccaacagacatgcaagctcaatttacagctttaatggcagtg
gtcaatggagagtctactatggttgaaactgtctttgaaaatcgatttcaacatctggaa
gaaatgcgacgcatgggcttacaatctgaaatccttagagaaactgccatgattcatggt
ggaagacaactgcaaggtgctcctgtgatgtcaacagatttacgtgccagtgctgccctt
atcttgacagggattgttgctcaaggagttacaatagttaataatttggttcatttagat
cgtggctactatcaatttcatgaaaaattagcaaagcttggagctactattagtcgtagc
agtgaggtctag

DBGET integrated database retrieval system