KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1427Help
Entry
SPs1427           CDS       T00119                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPs1427
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPs1427
Enzymes [BR:sps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPs1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429054..1429533
Genome map
AA seq 159 aa AA seqDB search
MPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQALQALYDTYHDKGFEVL
DFPCNQFLNQTPGEAEEINRFCSLTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGK
RIEWNFTKFLIDQNGQVIKRYSSKTDPKLIEEDLKALLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatctctatgattttacggttaaggctcaggacggcagtgacatctcactagtt
aactacaaagaaaaagtggttttggtcgtgaatacagctaccaaatgtggactaacccca
caataccaggccttgcaagcgctatatgacacataccatgacaagggatttgaggtctta
gattttccttgcaaccaatttctaaatcaaactccaggggaagccgaagagattaatcga
ttttgcagcttaacctatcacactactttccctcgctttgcaaaaatcaaagtaaatggt
aaagacgctgatcctttgttcacctggttaaaagaagaaaaaagtggtccccttgggaaa
cgcatcgaatggaatttcactaaatttctcattgaccaaaatggtcaagtcattaaacgc
tattcctcaaagacagatcctaaactaattgaagaagaccttaaagcacttcttggttaa

DBGET integrated database retrieval system