KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs1801Help
Entry
SPs1801           CDS       T00119                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sps00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPs1801 (ruvA)
Enzymes [BR:sps01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPs1801 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1826104..1826700)
Genome map
AA seq 198 aa AA seqDB search
MYDYIKGQLTKITAKYIVVEANGLGYMINVANPYSFTDSVNQLVTIYLHQVIREDAHLLF
GFHTEDEKDVFLKLISVSGIGPTTALAIVAVDDNEGLVNAIDNSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVEAPQETGHTKARSNKAGNTQLDEAIEALLALGYKAKELKKIRAFFEGT
SETAEQYIKSALKLLMKG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggtcaattgaccaaaattacggcaaaatacattgtcgttgaa
gctaatggattgggctacatgattaatgttgccaatccttatagctttacagatagtgtc
aaccaattggtaaccatttatctgcatcaagtgattcgtgaggatgctcacctgttgttt
ggttttcacacggaagatgaaaaagatgtttttctgaaattaatttctgtatcaggtatt
ggtccgacaacagctcttgctattgtggcagttgatgataatgagggacttgtgaatgcc
attgataacagtgacattaagtacctaatgaaatttcctaaaattggtaaaaaaacagcg
cagcaaatggttcttgacttagctggcaaatttgtggaggctccacaagagactggtcat
accaaagcgcgcagcaataaagcaggcaatactcaactggacgaagcgattgaagccctc
cttgccctcggttataaagcaaaagagctgaaaaaaattcgtgccttctttgaggggacc
tctgagacggcagagcaatacatcaaatcagcattgaaactgttaatgaaagggtag

DBGET integrated database retrieval system