KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_00006Help
Entry
SULPSESMR1_00006  CDS       T04974                                 

Gene name
paaJ
Definition
(GenBank) 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:spse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SULPSESMR1_00006 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    SULPSESMR1_00006 (paaJ)
   00640 Propanoate metabolism
    SULPSESMR1_00006 (paaJ)
   00650 Butanoate metabolism
    SULPSESMR1_00006 (paaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SULPSESMR1_00006 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    SULPSESMR1_00006 (paaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SULPSESMR1_00006 (paaJ)
   00310 Lysine degradation
    SULPSESMR1_00006 (paaJ)
   00380 Tryptophan metabolism
    SULPSESMR1_00006 (paaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SULPSESMR1_00006 (paaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SULPSESMR1_00006 (paaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SULPSESMR1_00006 (paaJ)
Enzymes [BR:spse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SULPSESMR1_00006 (paaJ)
Exosome [BR:spse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SULPSESMR1_00006 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4747..6030
Genome map
AA seq 427 aa AA seqDB search
MNCPVYLVDGARTPFLKARGKPGPFTPVDLAVQCGRPLLMRQPFASTAFDLVILGCVNVI
QDEMNPARVAALRMGMGDEQVAFTVQINCGSGMQSIDTAFRYIRDGSHKMIMAGGTEALS
HAPLVYNREATEWFGGMASAKGPMDKAAKLTELRPDFFSPVIGLERGLTDPITALNMGQT
AEVLAHRFGIDRQTADAYAVESHKRLAAAQSDGRLDGEVLPVFDRDGMAHATDDGVRPDN
SMEHLAKLDPAFEKPYGKVTPGNSSQITDGASWVILASETAVEAHGLTPIARLVDSEWAA
LDPSIMGLGPVLASTPLAQRHGLGVDDIDLWEINEAFAAQVLSCLAAWQDDAFCREVLGY
DVAFGRIDRGQLNVDGGAISLGHPVGASGNRIVLHLANAMQNKGVRRGIATECIGGGLGG
AMLLEAA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaactgccccgtttatcttgtcgatggtgcccgtaccccgtttctcaaggcacgcggt
aaaccggggccgttcacccccgttgatcttgcggtgcaatgcggtcggccactgttgatg
cgccagccttttgcatcgacggcatttgaccttgtgattctcgggtgtgtgaatgtgatt
caggatgaaatgaaccctgcccgcgtggcggcgctgcggatggggatgggcgacgaacag
gtcgcctttaccgtgcaaattaattgcgggtcaggaatgcaaagcatcgatactgccttt
cggtacatccgcgatggcagccacaagatgattatggcgggcggcaccgaggcgctgtcg
cacgcgccgctggtttacaaccgcgaggcaaccgagtggttcggcggtatggcaagcgcc
aaggggccgatggacaaggcagctaagctgaccgagttgcgtccggatttcttcagcccc
gttatcgggcttgaacgtgggctaaccgatccgattaccgcgctgaatatgggccaaacc
gctgaagtgctggctcaccggttcggcattgatcgccagaccgccgatgcctatgcggtg
gaaagtcacaaacggcttgctgcagcgcagtccgatggccgtctggacggtgaggtattg
ccagtctttgaccgtgacggcatggcccatgccacggatgatggcgttcgtcccgataat
tcgatggagcatctggccaagctggatccggcgttcgagaaaccctatggcaaggtcacg
ccgggcaattccagccagattacagatggagcgtcttgggtgatacttgcgtcggaaaca
gcggtcgaggcgcacgggctgacgccgattgcgcggctggtcgatagtgaatgggccgca
ttggatccgtcgattatggggcttggtccagttctggcgtcaacgccgttggcgcagcga
catgggctgggcgttgatgacatcgatctgtgggagatcaacgaagcttttgcggcgcag
gttttgtcctgtcttgccgcgtggcaggatgacgcgttctgccgcgaggtgctgggctat
gatgttgcctttggaaggatcgaccgggggcagttgaatgtggatggcggcgcgatcagt
ctggggcatcccgtcggggccagtggcaacaggatcgtgttgcaccttgccaatgcaatg
caaaacaaaggtgtccgccgtgggatcgccaccgaatgcatcggtggcgggctgggcggt
gccatgctgttggaggccgcgtaa

DBGET integrated database retrieval system