KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_02437Help
Entry
SULPSESMR1_02437  CDS       T04974                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:spse00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SULPSESMR1_02437 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    SULPSESMR1_02437 (phbA)
   00640 Propanoate metabolism
    SULPSESMR1_02437 (phbA)
   00650 Butanoate metabolism
    SULPSESMR1_02437 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    SULPSESMR1_02437 (phbA)
   00072 Synthesis and degradation of ketone bodies
    SULPSESMR1_02437 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SULPSESMR1_02437 (phbA)
   00310 Lysine degradation
    SULPSESMR1_02437 (phbA)
   00380 Tryptophan metabolism
    SULPSESMR1_02437 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SULPSESMR1_02437 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SULPSESMR1_02437 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SULPSESMR1_02437 (phbA)
Enzymes [BR:spse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SULPSESMR1_02437 (phbA)
Exosome [BR:spse04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SULPSESMR1_02437 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2478218..2479393
Genome map
AA seq 391 aa AA seqDB search
MTNVVIASAARTAVGSFTGSFAGTPAHDLGAAVLEAIVERAGIDKSEVSETILGQVLTAA
QGQNPARQAHINAGLPIESAAWSINQVCGSGLRAIALAAQHIQLGDASIVAAGGQENMSM
SPHAANLRMGHKMGDMQYIDTMIRDGLWDAFNGYHMGQTAENVAEKWQINRDQQDEFAVA
SQNKAEAAQKAGKFQDEITPFTVKGRKADIVVDSDEYIRHGATMEAMQKLRPAFTKDGSV
TAANASGLNDGAAGALLMSADNAEKRGIEPLARIVSYATVGLDPKIMGAGPIFASRKALE
KAGWKAEDLDLVEANEAFAAQACAVNKDMGWDPSIVNVNGGAIAIGHPIGASGARILNTL
VFEMKRRGAKKGLATLCIGGGMGVAMCIERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtcgtcatcgcctctgccgcacgcaccgctgtcggcagctttactggctct
tttgctggcacccccgcgcacgatctgggcgccgctgtacttgaggcgatcgtcgagcgg
gccggcatcgacaagtcggaggtcagcgagaccattctgggtcaggttctgaccgccgcc
caagggcagaatcccgcccgtcaggcacatatcaatgcaggcctgccaatcgaaagcgcc
gcatggagcatcaatcaggtgtgtggttccggcctgcgcgccatcgctttggcggcgcaa
cacatccagttgggtgatgccagcattgtggccgcaggcggtcaggaaaacatgtcgatg
agcccccacgccgcaaacctacgtatgggtcacaaaatgggcgacatgcaatacatcgac
acgatgatccgcgatggtctgtgggatgcgttcaacggttatcacatgggtcaaaccgcc
gagaacgttgccgaaaaatggcaaatcaaccgcgaccagcaggacgaattcgccgtagca
tcgcagaacaaggccgaagcggcccagaaggcgggcaagtttcaggacgaaatcaccccc
tttaccgtcaaaggccgcaaggcagacatcgttgtggacagtgacgaatacatccgccac
ggcgccacaatggaagcgatgcaaaaactgcgccccgctttcaccaaggacggatcggtg
acagctgccaacgcatcgggtctgaacgacggtgccgctggcgcgttgctgatgtccgcc
gacaacgccgaaaagcgcgggatcgagccgctggcgcgaatcgtatcctacgccacagtt
ggtcttgacccgaagatcatgggcgcgggcccgatctttgcctcgcgcaaagccttggaa
aaggccggttggaaggctgaagatctggatctggtcgaagccaacgaagcctttgccgcg
caggcctgtgccgtgaacaaggatatgggctgggatccatccattgtgaacgtcaacggc
ggcgccatcgccatcggccaccccatcggcgcatctggcgcgcgaattctgaacactttg
gtgttcgaaatgaaacgccgtggtgccaaaaagggccttgctacactgtgcatcggcggc
ggcatgggtgtcgcaatgtgcatcgaacgcccttaa

DBGET integrated database retrieval system