KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA0088Help
Entry
SPA0088           CDS       T00219                                 

Gene name
folA
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:spt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
100735..101214
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVNSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcggacgccccttaccgggacgtaaaaatatt
gttatcagcagccagccgggcaccgacgatcgcgtgcagtgggtgaattctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggtcattggcggcgggcgcgtgtac
gagcagttcctgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system