KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA0088Help
Entry
SPA0088           CDS       T00219                                 

Gene name
folA
Definition
dihydrofolate reductase type I
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPA0088 (folA)
   00670 One carbon pool by folate
    SPA0088 (folA)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPA0088 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
100735..101214
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVNSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcggacgccccttaccgggacgtaaaaatatt
gttatcagcagccagccgggcaccgacgatcgcgtgcagtgggtgaattctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggtcattggcggcgggcgcgtgtac
gagcagttcctgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system