KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA0772Help
Entry
SPA0772           CDS       T00219                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SPA0772 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPA0772 (rfbC)
Enzymes [BR:spt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SPA0772 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
862983..863525
Genome map
AA seq 180 aa AA seqDB search
MIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKSKKNVLRGLH
FQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFV
TLSDYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQALLTE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaacagcaataccagatgtcttgatcttagagcctaaagtttttggcgatgag
aggggattcttttttgaaagttataaccagcagacctttgaagagtcgattggacgtaaa
gttacatttgttcaagataatcattcaaaatccaaaaagaatgtactcagagggctacat
tttcagagaggagaaaatgcacagggaaagttagttcgctgtgctgtcggtgaggttttt
gatgttgcggtcgatatccgaaaagaatcacctacttttggtcagtgggttggcgtaaat
ctatctgctgagaataagcgacagctttggattccagaaggttttgctcatggttttgtt
actctcagtgattatgcagagtttctgtacaaagcaactaattattactcaccttcatcg
gaaggtagcattctatggaatgatgagacaataggtattgaatggcctttttctcagctg
cctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttgttaacagag
taa

DBGET integrated database retrieval system