KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA0951Help
Entry
SPA0951           CDS       T00219                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:spt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SPA0951 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SPA0951 (cheB)
Enzymes [BR:spt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SPA0951 (cheB)
Two-component system [BR:spt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SPA0951 (cheB)
Bacterial motility proteins [BR:spt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SPA0951 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1023336..1024385
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAAHKPMAAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtattgtcagttgatgattccgcgctaatgcgccaaatcatgact
gaaattattaatagccatagcgatatggagatggtggcgactgcgccggacccgttggtc
gccagggatctcatcaaaaaatttaatccggacgtattgaccctggacgttgagatgccg
cgtatggacggcctcgattttctggaaaaactgatgcgcctgcgaccgatgccggtggtg
atggtctcttcgctgaccgggaaaggttccgaagtgacgctacgggcgctggagttgggg
gccatcgattttgtcactaaaccgcagcttggcattcgtgaaggtatgctggcgtatagc
gagatgatcgccgaaaaagtgcgtaccgctgcgcgggcccgcatcgccgcacataaaccg
atggcggccccgacaaccttaaaagccggtccgctgctcagttcggaaaaactgattgct
atcggcgcttcaacgggcggtactgaagctatccgacatgtgctgcaaccgctgccgctt
tccagtccggcagtgattattacgcagcatatgccgcctggctttacccgctcgtttgcc
gagcgtctgaataaactctgtcaaatcagcgtgaaggaggcggaggacggcgaacgcgta
ttgccaggtcatgcctacattgcgcccggcgacaagcatatggagctggcgcgtagcggg
gcgaattatcaaatcaaaattcatgatggcccgccggtaaaccgacatcggccttccgtg
gatgtgctgtttcattcggtggcgaaacacgcggggcgcaacgccgtaggcgtcattctt
acggggatgggcaacgatggcgccgctggaatgttagcgatgtaccaggctggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtaagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcgatacgtatttga

DBGET integrated database retrieval system