KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1094Help
Entry
SPA1094           CDS       T00219                                 

Gene name
ipk
Definition
isopentenyl monophosphate kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:spt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1164630..1165478)
Genome map
AA seq 282 aa AA seqDB search
MTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVNGVE
NEDNLIVRAAQLLMKIASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHL
WQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIPT
PVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacagcgt
gcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacacactc
cacatcgaaccgcgtcgcgatggcgaaatccatttattaacgccggttaacggcgttgaa
aatgaagacaatctgatcgtccgcgccgcgcaactgttgatgaaaatcgcctcggagagt
ggacgcctgcccgccggaagcggcgcggatatcagcattgagaagcgccttcccatgggc
ggcggtctgggtggcggctcgtctaacgccgcgaccgttctggtggcgctcaatcatctt
tggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgccgac
gtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatattaacg
ccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccgacg
ccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagatacg
ttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgcgag
gttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggacaggg
gcctgtgtctttgctgaattcgatacagagtcctgtgctcgccaggtgcttgagcaagcc
ccggaatggctcaatgcttttgtggcgaagggtgtcaacctctccccattgcatcgagag
ttactctaa

DBGET integrated database retrieval system