KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1126Help
Entry
SPA1126           CDS       T00219                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPA1126 (galU)
   00052 Galactose metabolism
    SPA1126 (galU)
   00500 Starch and sucrose metabolism
    SPA1126 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SPA1126 (galU)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPA1126 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1193596..1194504
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVEDVTAYGV
VDCKGVELAPGESVPIVGVVEKPKADVAPSNLAIVGRYVLSADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattcgaaagtcaaaaaagccgttatcccggtcgcgggattgggaacc
aggatgctgccagcgaccaaagctatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtacgtcgtgaacgaatgtatcgctgctggcattactgaaatcgtgcttgtt
acgcactcgtctaaaaactctattgaaaaccactttgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgtcagcttctggaggaggttcagtctatttgccctccg
catgtcactattatgcaggtacgtcaagggctggcaaaaggcctgggccatgccgtattg
tgcgcgcatcccgttgtcggaaacgaacctgtcgctgttattctgccagacgttattctt
gacgaatatgagtccgacctgtctcaggataacctggctgaaatgatccgccgtttcgac
gaaaccggcaatagccagattatggttgagccagtagaagatgtgactgcatacggcgtg
gtcgattgcaaaggcgttgagctggcgccgggcgaaagtgtgccgatagttggcgtggtt
gaaaaaccaaaagcggatgtcgcgccgtctaaccttgcgattgtcgggcgttatgtgttg
agcgcggatatctgggcgttgctggcgaaaacccctccgggcgccggggatgaaattcag
ttgaccgatgctatcgatatgctgatcgaaaaagaaacggttgaagcctaccacatgaag
ggtaaaagccatgactgtggtaataagttaggatatatgcaggcattcgttgaatatggc
atccgtcataattcgctgggtgctgaatttaaagcctggcttgaagaagaaatgggtatt
aagaagtaa

DBGET integrated database retrieval system