KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1301Help
Entry
SPA1301           CDS       T00219                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00010  Glycolysis / Gluconeogenesis
spt00071  Fatty acid degradation
spt00350  Tyrosine metabolism
spt00625  Chloroalkane and chloroalkene degradation
spt00626  Naphthalene degradation
spt01100  Metabolic pathways
spt01110  Biosynthesis of secondary metabolites
spt01120  Microbial metabolism in diverse environments
spt01130  Biosynthesis of antibiotics
spt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPA1301 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SPA1301 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPA1301 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPA1301 (adhP)
   00626 Naphthalene degradation
    SPA1301 (adhP)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPA1301 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C SCP2 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AAV77249
UniProt: A0A0H2WP23
Position
complement(1381405..1382415)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPEGLDSAAASSITCAGVATYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINVIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagctttgctaaaaatggagtgctgcggtgtatgccataccgat
ctacacgtgaaaaacggagatttcggtgacaaaaccggcgttattctgggacacgaaggc
attggcgtcgtggcggaagtcggtcctggtgtcacctcgctgaaacccggcgatcgcgcg
agtgtcgcgtggttttatgaaggatgcggacactgtgagtattgcaatacgggcaatgaa
accttatgccgcaacgtgaaaaatgccggttacacggtagatggcggcatggccgaagag
tgtattgtcgtcgcggattatgcggtgaaagtaccggaaggcctggactctgcggcggca
agtagtattacctgcgcgggcgttgccacctataaagcggtgaagatttctcatattaaa
cctggccagtggattgccatctacggtctgggcggtctgggtaatctggccttgcagtac
gcgaaaaacgttttcaatgcgaaagtgatcgccattgatgtcaatgatgggcaactgaaa
ctggccgaggaaatgggcgcagatctgaccattaattcacgtacggaagatgcggctaaa
attgtgcaggaaaaaaccggtggcgcgcacgcagcggtggttaccgcggtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtggtggcggtcgggctg
ccgccagaagccatgaaccttgatatccctcgcctggtgctggatggcattcaggttgtc
ggttcgttggtggggacacgccaggatctgaccgaagccttccagttcgcggcggaagga
aaagtcgtgccaaaagtcgctttacgtccgcttgaagatatcaacgttatttttaaagag
atggaacagggacaaattcgtggccgtatggtcatcgatttccgtcgttaa

DBGET integrated database retrieval system