KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1330Help
Entry
SPA1330           CDS       T00219                                 

Gene name
yneH
Definition
(GenBank) hypothetical protein
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00220  Arginine biosynthesis
spt00250  Alanine, aspartate and glutamate metabolism
spt00471  D-Glutamine and D-glutamate metabolism
spt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPA1330 (yneH)
   00220 Arginine biosynthesis
    SPA1330 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SPA1330 (yneH)
Enzymes [BR:spt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SPA1330 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AAV77275
UniProt: Q5PN90
Position
complement(1413337..1414251)
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagagacgattttacagcgcgttcgccccctcattggccagggc
aaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaagctggggatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgcttagtctggtggtggcgatgcgtcattatccggaagaggag
atctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaagttgtgcgcgcg
ctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattacttccactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagttacccccatgcaggcccgacagattaatgcgctaatggcgaccagcgggatgtat
cagaatgccggagagtttgcctggcgggtgggattgcccgctaaatccggcgtgggcggc
ggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgaacaattaacacaaacgttagga
cgttcggtatactga

DBGET integrated database retrieval system