KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1642Help
Entry
SPA1642           CDS       T00219                                 

Gene name
ycfO
Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPA1642 (ycfO)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SPA1642 (ycfO)
Enzymes [BR:spt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPA1642 (ycfO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1706559..1707572)
Genome map
AA seq 337 aa AA seqDB search
MLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETPCDPR
PETDIRGKDMSVFRALISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagatactggcgcatccg
ctggttggcgggcttattctgttcacgcgtaattaccatgacccggaacagctgcgcgaa
ttagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggccgtcgatcaggaa
ggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcggcgcaatctttt
tttgcgctgcatgggctggaagagggggggcgactggcgcaggaggcagggtggctgatg
gccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtgctggatgtcggg
catatcagcgcggcaattggcgagcgttcttatcatgccgatcccgcaaaagcgttggca
atggcaacacgctttattgacggtatgcatgacgccgggatgaaaacgaccggtaagcat
ttccccggccacggcgcggtcacggcggactcccacaaagagacgccgtgcgatccacgt
cctgaaacggacatccgtggcaaagatatgtcggtgttccgcgcgctgattagtgagaat
aaactggatgcgattatgcctgcccacgtaatctaccgcgctatcgatccacgcccggca
agcggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggctttgacggcgtc
attttctccgacgatctgtcgatggagggcgcggcgattatgggcagctatgctgagcgc
gctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaataatcgtaaaggc
gcagtcagcgtgttggataatctgtcgccgatcaaagcagaacgtgttacacgtttgtat
cataaaggttcattttcacgccgggagctcatggactcagcacgctggaaaacagccagc
gcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggtcattaa

DBGET integrated database retrieval system