KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2006Help
Entry
SPA2006           CDS       T00219                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00020  Citrate cycle (TCA cycle)
spt00310  Lysine degradation
spt01100  Metabolic pathways
spt01110  Biosynthesis of secondary metabolites
spt01120  Microbial metabolism in diverse environments
spt01130  Biosynthesis of antibiotics
spt01200  Carbon metabolism
Module
spt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPA2006 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SPA2006 (sucB)
Enzymes [BR:spt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPA2006 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AAV77909
UniProt: A0A0H2WQL5
Position
complement(2084775..2085983)
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggtgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggacgactgtcacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagaccagcgccaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcgtcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcacaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgtaagcgcgtggccgagcgtctgctggaagcgaaaaattccaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagta
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtac
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacattgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagacctgaccggcggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacctggcgctctcttacgatcatcgcctgatcgatggtcgcgaa
tccgtgggcttcctggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system