KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2224Help
Entry
SPA2224           CDS       T00219                                 

Gene name
ybaR
Definition
copper-transporting ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Brite
Enzymes [BR:spt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     SPA2224 (ybaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2312619..2315120
Genome map
AA seq 833 aa AA seqDB search
MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVELADVTVTEAHVTGTASADALIETIKQAE
YGATLSHPKAKPLTESSIPSEALAAVPHELPVATADEESQQLLLSGMSCASCVTRVQHAL
QSVPGVTQARVNLAERTALVMGSASAADLVQAVEKAGYGAEAIEDDIKRRERQQETAIAT
MKRFRWQAIVALAVGIPVMVWGMIGDNMMVTGDNRSLWLAIGLITLAVMVFAGGHFYRNA
WKSLLNGTATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHM
LEARARQRSSKALEKLLDLTPPTARVVTEDGEKSVPLADVQPGMLLRLTTGDRVPVDGQI
TQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVLFRASAVGSHTTLSRIIRMVRQ
AQSSKPEIGQLADKISAVFVPVVVAIALFSAAIWYFFGPAPQIVYTLVIATTVLIIACPC
ALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGKPQVVAVKTF
NGVDEAQALRLAAALEQGSSHPLAHAILEKAGDDKLPQVNGFRTLRGLGVSGEAEGHQLL
LGNQALLNEQHVATDDMTAEITAQASQGSTPVLLAIDGKAAALLAVRDPLRSDSIAALER
LHNAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKADAIKRLQSQGRQVAMVGDG
INDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRAMLRNMKQNLLGA
FIYNSIGIPVAAGILWPFTGTLLNPVVAGAAMALSSITVVSNANRLLRFKPKA
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaactatcgacctgaccctggacggtttgtcctgcggtcattgcgttaaacgc
gtgaaagaaagccttgaacaacgtccggatgttgagctggcggacgttaccgtaaccgaa
gcgcacgttaccggtaccgccagtgcggacgcgttaattgaaaccatcaaacaagccgag
tatggcgcgacattaagccacccaaaggctaaaccgctgacggagtcatcaatcccgtcg
gaagcactggcagcggttcctcatgagcttccggtagcgacggccgatgaagaaagccaa
cagttgctgttaagcggcatgagctgcgccagttgtgtcacccgcgtacaacatgcgcta
caaagcgtaccgggcgtcacgcaggcacgggtaaacctggcggaacgcactgcgctggtg
atgggcagcgcgtccgccgctgatttagtgcaggcggtggaaaaagccggctacggcgca
gaagcgattgaagatgacatcaaacgccgcgagcgccagcaggaaaccgccatcgccacc
atgaaacgttttcgctggcaggcaatcgtcgccctggcggtcggtataccggtcatggtc
tgggggatgatcggcgataacatgatggtgaccggcgacaaccgcagcctgtggctggct
attggcctgatcacgcttgcggtgatggtctttgcgggcggtcacttttaccgtaacgcg
tggaaaagcctgctgaacggcacggcgacgatggatacgctggtggcgctcggcaccggg
gtcgcctggctctactccatgagcgtcaacctgtggccgcagtggttcccgatggaagcg
cggcacctctattacgaagccagcgcgatgattatcggtctgattaatctcggacacatg
ctagaagcgcgcgcccgtcagcgttcctcaaaagcgctggaaaaattactcgatctcacc
ccgcccaccgcacgcgtcgtgacagaagacggcgaaaaaagcgtcccgctggcggacgtt
cagccggggatgctgctgcggctcactaccggcgatcgcgtgccggtggatggccaaatt
acccaaggcgaagcgtggcttgatgaagccatgctgaccggcgaacccattccgcagcaa
aaaggcgaaggcgacagcgttcatgccggcaccgtcgtccaggacggcagcgtcctgttc
cgcgccagcgcggtgggcagtcataccacgctgtcacgcattattcgcatggtacgccag
gcgcaaagcagtaaaccggaaattggccaactggccgataaaatctccgcggtattcgtt
cccgtcgtcgtggccattgcgctgttcagcgccgctatctggtatttcttcggaccggcg
ccgcaaattgtttatacgctggtcatcgccaccaccgtactgattatcgcctgcccttgc
gcattaggcctggcgacgccaatgtcgattatttccggtgtaggccgcgctgccgaattc
ggcgtgctggtacgcgacgccgatgccctgcaacgcgccagtacgttggataccctcgtt
tttgataaaaccgggacgctgacggaaggcaagccgcaagtggtggcggtaaaaaccttt
aacggcgttgatgaagctcaggcattacgtctggcagccgcgctcgaacaaggctccagc
cacccgctggcccatgcgattctggaaaaagccggcgacgataaactgccgcaggtgaac
ggtttcagaactctgcgcggactgggcgtcagcggtgaagcggaaggccatcaactgctt
ctggggaaccaggcgttgctgaacgaacagcacgtcgccacggatgatatgacggcggaa
atcaccgcgcaggcctcgcaaggctcgactccggtcctgctggcgattgacggtaaagcg
gcggcgttactggcggtacgcgatccattgcgcagcgatagtattgccgcgcttgaacgc
ctgcacaacgccggataccgtctggtaatgctcaccggggataacccaacgacggctaac
gcgattgccaaagaagcgggtattgacgaagtcattgcgggcgttctgccggatggcaaa
gccgatgcgattaaacgtctgcaaagccagggtcgtcaggttgcgatggtcggcgatggt
atcaacgatgcgcccgcgctggcgcaggcggacgtcggtatcgcgatgggcggcggcagc
gatgtggcgattgaaaccgcggcgattacgctgatgcgccatagtctgatgggcgtggcg
gatgcgctggccatttcgcgcgcgatgttgcgcaatatgaagcaaaacctgcttggcgca
tttatctacaacagcattggtatcccggtggccgccggtattctgtggccatttaccggt
accttgttaaacccggtagtagcgggcgcggcaatggcgctgtcttccattaccgtcgtg
agcaatgccaaccggctattgcgctttaaaccgaaagcgtaa

DBGET integrated database retrieval system