KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2575Help
Entry
SPA2575           CDS       T00219                                 

Gene name
nucD
Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2677255..2677725)
Genome map
AA seq 156 aa AA seqDB search
MLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIGNTSGVVPGKTITE
RQAAQGLITNVLRVERALEKCVVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRW
ADACHQLPRWVYVKGVFNQGLDNRRAREMAWCLKGA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgctggctatcgcagccacgctgcccggatttcagtcgcttcatacctccgttgagggg
ctgaaactgatcgccgattacgagggatgccgcctgcagccttatcagtgtagcgcgggc
gtctggactgacgggatcggcaatacgtccggtgtggtgcctggaaaaaccatcacggaa
cggcaggcggcgcagggacttatcaccaatgtgctgcgcgtggagcgggcgctggaaaaa
tgtgtggtgcagccgatgccgcaaaaggtctatgacgcggtggtgtcgtttgctttcaac
gtgggcaccggcaacgcctgcagctccacgctggttaagttgctgaaccagcggcgctgg
gcggatgcctgccatcagctgccgcgctgggtatatgtcaaaggtgtgtttaatcagggg
ctggacaaccgccgcgcgcgggaaatggcctggtgcttaaaaggagcctaa

DBGET integrated database retrieval system