KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3174Help
Entry
SPA3174           CDS       T00219                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:spt00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3282362..3283621)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTTLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDASQVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHITGLEQLGATIKLEEGYVKASVEGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLVTLGAKIAGQGTDRITIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKILCRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGARAEIESNTVICHGVETL
SGAQVMATDLRASASLVLAGCIAEGTTIVDRIYHIDRGYERIEDKLRALGANIERVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgtacaggggccaacgacgctccagggcgaagtcacaatttccggc
gccaaaaacgccgcgctgccgatcctgttcgccgctctgctggcagaagaaccggtagag
atccaaaacgttccaaaactgaaagacgtggatacgtcgatgaagctcctgagccaatta
ggcgcgaaagtggaacgcaatggatcggtacacattgacgccagccaggtgaacgtgttc
tgcgcgccttatgatctggttaagaccatgcgcgcctcgatatgggcgctggggccgctg
gttgcccgttttggtcagggacaagtctctctgccggggggctgtactattggcgcgcgt
ccggttgatctgcatattaccggtctggaacaactgggtgcgaccatcaagctggaagag
ggctacgtaaaggcctccgtcgaagggcgtcttaaaggggcgcatatcgtgatggataag
gtcagcgtcggcgcgaccgtcaccattatgtgcgccgctacgctggcggaagggacgacc
atcattgaaaacgccgcgcgcgagccggaaattgtcgacaccgctaacttcctggttacg
ctgggggcgaagatcgccgggcagggcaccgatcgtattacgatcgagggcgtagagcgt
ctgggcggcggcgtttatcgtgtgctgccggatcgtatcgaaacggggactttcctggtg
gcggcagcgatctctcgcggcaaaatcctctgccgtaacgcgcaaccggacactctggac
gcggtactggcgaaactgcgcgatgctggcgcggatatcgaagtgggcgaggactggatt
agtctggacatgcacggcaaacgaccgaaggcggtcaatgtccgtaccgcgccgcacccg
gcattcccgaccgatatgcaggcgcagttcacgttgctgaacctggtggcggaagggacg
ggctttatcactgaaactgtctttgaaaaccgttttatgcacgtgcctgaactcagccgc
atgggcgcgcgtgcggaaattgaaagcaataccgtcatatgccatggcgtagaaacgctc
tctggcgcccaggtcatggcgacagatctgcgggcatctgcgagcctggtgctggcgggc
tgtattgcggaaggcacgacgattgtggatcgcatttatcacatcgatcgcggttatgag
cgcatcgaagacaaactgcgcgcgctaggcgcgaatattgaacgcgtgaaaggcgaataa

DBGET integrated database retrieval system