KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3512Help
Entry
SPA3512           CDS       T00219                                 

Gene name
xylA
Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:spt00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spt00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3634418..3635695)
Genome map
AA seq 425 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSCAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKMGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKIAARMVEDGELGQQILKGQLSLGKLAQYAEQHHLAPVHQSGHQELLENLVNR
YLFDK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgtgttcgctatgaaggccctcaatcgactaac
ccgctggcatttcgtcattacaatcccgacgagctggttttaggtaaacgtatggaagat
cacctgcgtttcgcggcctgttactggcataccttctgctggaacggcgcggatatgttt
ggtgtaggcgcgtttaatcgtccgtggcagcaaccgggcgaagcgctggagctggcgaaa
cgcaaagcggacgtggcgtttgaatttttccacaaactgaatgtgcctttttactgcttc
catgacgtggatgtgtcgccggaaggcgcgtcgttgaaagagtataaaaacaacttcgcg
cagatggtggatgtgctggcggcgaaacaggagcagagcggcgtaaaactgctgtgggga
acggcgaactgctttaccaacccgcgctatggcgcaggcgccgccactaacccggacccg
gaagtctttagctgtgcagcgacgcaagtggttacggcaatgaacgccacgcataaactg
ggcggcgaaaattacgtcctgtggggcggacgcgaaggttatgaaacgttgctgaatacc
gatctacgccaggaacgcgaacagattggccgctttatgcaaatggtggttgagcacaaa
cataaaatgggtttccagggcacgctgctgattgaaccgaaaccgcaggaaccgacaaaa
catcagtatgattatgacgttgcaacggtctatggcttcctcaaacagttcggcctggaa
aaagagatcaaagtgaacattgaggcgaaccacgccacgctggcgggccattcgttccac
catgaaatcgcaaccgctatcgcgctgggtatttttggctccgttgacgccaaccgcggc
gatgcgcaactgggctgggataccgatcagttcccgattagcgttgaagagaacgcgctg
gtgatgtacgaaatcctgaaagcgggcggattcacgacgggcggtctcaacttcgacgcc
aaagttcgtcgccagagcaccgataaatacgatctgttctacggtcatatcggcgcgatg
gatacgatggcgttgtcactgaaaatcgccgcgcgtatggtcgaagacggcgagctgggg
cagcagattctgaaaggacaactctccttaggcaaactggcgcagtatgcggagcagcac
catctggcgccggtacatcaaagcggtcatcaggagctgttagaaaatctggttaaccgt
tatctgtttgataaataa

DBGET integrated database retrieval system