KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3625Help
Entry
SPA3625           CDS       T00219                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPA3625
Enzymes [BR:spt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPA3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3764084..3765457
Genome map
AA seq 457 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPDRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLL
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTAVRAGRYDGEIGIVLNLTPSYPRSQHPADVQAAHHAD
LLFNRSFLDPVLKGEYPADLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPRRVK
CRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRCFIS
ENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWSWLN
GYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagcctgatcgttttcaccagggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgctc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgtgcggccaccgtggcgtaccataccgtgctggcg
cactcgaccgccgtgcgcgccgggcgctacgacggtgaaatcggcatagtactgaatctg
acgccgtcctacccacgctcacagcatcccgccgatgtgcaagccgcgcaccatgcggat
ctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccggcggatctg
gtggcgctgctgaaaacctatgaccagctgcctgcctgtcagccaggcgaccgtcagctt
attgccgacggcaaaatcgatttactggggattaactattatcagccgcgccgcgtgaaa
tgccgtgatacggcggtgaatccgcaagcgccgtttatgccggagtggttatttgactat
tacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttacgcgccagga
atttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgttttatctcc
gaaaacgggatgggcgttgagaacgagcaacgttttgtgcaagcgggacagattcacgat
gattaccggattgactttatctctgagcatcttaaatggctgcataaaggcattagcgag
ggctgtcactgtcttggctaccacatgtggacctttatcgataactggtcatggctgaac
ggctataaaaatcgctatggttttgtacaactggatttagccacccaaacgcgcacggtg
aaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgattaa

DBGET integrated database retrieval system