KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3798Help
Entry
SPA3798           CDS       T00219                                 

Gene name
pldA
Definition
detergent-resistant phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spt00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:spt00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:spt00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:spt00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3939842..3940711
Genome map
AA seq 289 aa AA seqDB search
MRAILRGLLPATLLPLAAYAQEATIKEVHDAPAVRGSIIANMLQEHDNPFTLYPYDTNYL
IYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGILGPNSVLGASYTQKSWWQL
SNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYNHDSNGRSDPTSRSWNRLYT
RLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGYHLGEAVLSAKGQYNWNTGY
GGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGVGVMLNDIF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattttgagagggttgttgccagccacgctactgccattagcggcatatgca
caagaagctacgataaaagaggttcatgatgcgcctgcagtacggggaagtatcatcgct
aacatgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttg
atctacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaa
aacgcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcgga
atactggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctt
tccaacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttctt
ggttttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctac
aaccatgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacc
cgtctgatggccgaaaacggtaactggctggtagaggtcaaaccatggtacgtgattggc
agtaccgacgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggt
tatcacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctac
ggcggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccag
gtgtatagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggc
gtcggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system