KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3924Help
Entry
SPA3924           CDS       T00219                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPA3924 (tpiA)
   01230 Biosynthesis of amino acids
    SPA3924 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPA3924 (tpiA)
   00051 Fructose and mannose metabolism
    SPA3924 (tpiA)
   00562 Inositol phosphate metabolism
    SPA3924 (tpiA)
Enzymes [BR:spt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPA3924 (tpiA)
Exosome [BR:spt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPA3924 (tpiA)
  Exosomal proteins of bladder cancer cells
   SPA3924 (tpiA)
  Exosomal proteins of melanoma cells
   SPA3924 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4068311..4069078)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactggcgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtgtgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaactcct
gcgcaggctcaggcagtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggtcattatccagtacggcggttctgttaatgcctccaacgcagccgaa
ctgttcgcgcagccggacatcgacggcgcactggtaggcggcgcttctctgaaagctgac
gccttcgcggtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system