KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA3929Help
Entry
SPA3929           CDS       T00219                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPA3929 (glpK)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SPA3929 (glpK)
Exosome [BR:spt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPA3929 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4072390..4073898)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
LEDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRAMAWEEHDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtc
gttatggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttat
cctaagccaggctgggtagaacacgacccgatggaaatttgggcgtcccaaagctcaacg
ctggtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatc
accaaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaac
gctattgtctggcagtgccgtcgtaccgccgatatttgcgaacagcttaaacgcgacggc
ctggaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcact
aaagtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgag
ctgctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccac
gttacggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgg
gacgataagatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaag
tcctccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatc
gccgggattgcaggggatcagcaggccgcgctattcggccaactgtgcgtaaaggaagga
atggcaaagaatacctacggcaccggctgctttatgctgatgaacaccggcgaaaaagcg
gtaaaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaac
tatgcgctggaaggcgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaa
atgaagctcatcagcgacgcgttcgactccgaatatttcgccacgaaagtgaaagatacc
aacggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggacccgtat
gcccgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgca
acgctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactcc
ggtatccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatg
cagttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgacc
gcgctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgag
ctgcaggaaaaagccgtcattgagcgagaattccgccccggcattgaaactaccgagcgt
aactaccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcac
gacaagtaa

DBGET integrated database retrieval system