KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA4021Help
Entry
SPA4021           CDS       T00219                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPA4021 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPA4021 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SPA4021 (aceB)
Enzymes [BR:spt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SPA4021 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4174121..4175722
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVMDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVSLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKACHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccagttgaacgt
aaaatggtgattaatgccctgaacgcaaacgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttatggatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactataaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaagcagcctggtggagtgaagttttcagctacgccgaagaccgctttaacctgccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgctgccggctgttttccagatggatgag
attcttcatgcgctgcgtgatcatatcgtcagtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcttgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaagcctgtcac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagctaacaacggc
catgacggcacgtggattgcgcatcccgggttggcggataccgcaatggccgtctttaac
gaggtgctgggcgagcacaaaaatcagttgttcattacccgtgatgaagatgcgccaatt
accgctgagcagttactggagccatgtgaaggcgaacgtacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system