KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA4116Help
Entry
SPA4116           CDS       T00219                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPA4116 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPA4116 (melA)
   00600 Sphingolipid metabolism
    SPA4116 (melA)
Enzymes [BR:spt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SPA4116 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4294334..4295686
Genome map
AA seq 450 aa AA seqDB search
MTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSAG
ASGRITCHTHQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWRICEDMMEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLNIDPASLRYRCAGINHMAFYLELERKTADGTYVDLYPELLAAYDAGQAPKPNIH
GNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCVE
QLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGSC
VEVACLVDANGIQPAKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT
AAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaatatc
ctcggcgatgtgtttcaccgcgaggcgctaaaatcagcgcatgtcgccctgatggatatt
gacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcgggc
gcttcaggccggattacctgccatacccaccagaaagcggcgctacaggatgcggatttc
gtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgaggtt
tgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcattatg
cgcgcgctgcggactatcccgcatctgtggcggatttgcgaagacatgatggaagtctgt
ccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatgtat
gcccgctatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcggaa
gaactggcgcgcgacctgaatatcgatcccgcctcgctgcgctatcgctgcgccggcatt
aaccacatggcgttttacctcgaactggagcgcaaaacggctgacgggacttatgtcgat
ctctatcctgaattgctggcggcctatgacgccggacaggcgccgaagcccaatattcac
ggcaatgaacgctgccagaacattgtgcgctatgagatgttcaaaaagttgggctacttc
gtcaccgagtcatcagagcattttgccgagtacacgccgtggtttattaaaccgggacgc
gaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgtagaa
caactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgacatc
aaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccgagc
gtgatttacggcaatgtgcgtaatgaggggctgattgataacctgccgcagggaagctgc
gtggaagtggcttgtctggtggatgccaacggcattcaaccggcgaaggtggggacgatc
ccttcccatctggcggcgatgatgcagaccaacatcaacgtgcaaacgctgttgaccgaa
gccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcatacc
gcggcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcgcat
ggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system