KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA4277Help
Entry
SPA4277           CDS       T00219                                 

Gene name
holC
Definition
DNA polymerase III, chi subunit
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPA4277 (holC)
   00240 Pyrimidine metabolism
    SPA4277 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPA4277 (holC)
   03430 Mismatch repair
    SPA4277 (holC)
   03440 Homologous recombination
    SPA4277 (holC)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPA4277 (holC)
DNA replication proteins [BR:spt03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SPA4277 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4449941..4450423)
Genome map
AA seq 160 aa AA seqDB search
MATHLNPPQEASYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcatttaaatccaccacaagaagcctcatatatgaagaatgcgacgttctat
cttctggacaatgacaccaccgtcaacggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgctggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggctggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaatcgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system