KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA4371Help
Entry
SPA4371           CDS       T00219                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00230  Purine metabolism
spt00240  Pyrimidine metabolism
spt01100  Metabolic pathways
spt03030  DNA replication
spt03430  Mismatch repair
spt03440  Homologous recombination
Module
spt_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SPA4371 (holD)
   00240 Pyrimidine metabolism
    SPA4371 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPA4371 (holD)
   03430 Mismatch repair
    SPA4371 (holD)
   03440 Homologous recombination
    SPA4371 (holD)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SPA4371 (holD)
DNA replication proteins [BR:spt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SPA4371 (holD)
DNA repair and recombination proteins [BR:spt03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SPA4371 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi Inhibitor_I66
Motif
Other DBs
NCBI-ProteinID: AAV80094
UniProt: A0A0H2WVR6
Position
4544838..4545275
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVVMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgtcatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system