KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA4382Help
Entry
SPA4382           CDS       T00219                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPA4382 (deoA)
Enzymes [BR:spt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SPA4382 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4554906..4556228
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIQDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGNLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggtattcgtgacaatactatctctgaagggcagattgcc
gccctggcgatgaccatcttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgtccttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtaggggacgtgacgtctctgatgctggggcca
atggtagcggcctgcggcggttatgtgccgatgatctccggtcgcggtctcggacatacc
ggcggtacgctcgacaaactggaagcgatcccgggctttgatatcttcccggacgacaac
cgtttccgcgaaattattcaagacgtgggtgtggcgattattgggcaaaccagctcgctt
gcaccggcggacaaacgtttttacgccacccgcgatattaccgcgacggtggactctatt
ccgctgatcaccggttccatcctcgccaagaaactggccgaagggctggatgcgctggta
atggacgtaaaagtcggcagcggcgcgtttatgccaacctatgaactttctgaagccctt
gctgaagcgattgttggcgtggcaaacggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcgagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcttgtttgacgtcaccatggcgctgtgc
gtggagatgctgatctccggcaatctggcaaaagatgacgccgaagcgcgtgccaaactg
caggcggtgctggataacggtaaagcggcagaagtctttggccggatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcggtatatgctgataccgaagggtttatcagcgcaatggatacgcgtgcgctgggg
atggcggtcgtctcgatgggcggcggccgtcgtcaggcgtctgataccattgattacagc
gttggctttaccgacatggcccgtctgggcgacagcatcgacgggcagcgcccgctggcg
gtgattcatgccaaagacgaagccagttggcaggaagcggcgaaggccgtcaaagcggca
attatccttgacgataaagcgccagcaagcacaccttcggtctatcgtcgaattactgaa
tag

DBGET integrated database retrieval system