KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100048986Help
Entry
100048986         CDS       T01019                                 

Gene name
eif4e1
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100048986 (eif4e1)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100048986 (eif4e1)
Translation factors [BR:spu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100048986 (eif4e1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 225 aa AA seqDB search
MASVGVAKLPLHEDIVKDGKGIKDLQTQDEDGANQVVDPESLIKHPLQSRWSMWFFKNDK
AKSWTENLRTVTAFDTVEDFWALYNHIQVASRITSGCDYSLFKEGVKPMWEDDKNKDGGR
WLIGFDRKSKPQDIDRCWLETMLLMVGESFDDDSDLVNGAVVNIRSKGNKIAMWTGDWRK
EDSITNIGRKFKERLGLPAKYSIGYEAHKDTMTKTGSMAKSLYTV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgttggtgtagcaaagcttccccttcatgaggatattgttaaagatgggaaa
ggtataaaggatttgcaaacacaggatgaagatggcgccaaccaggtcgtcgatccagag
agtctgatcaagcatccgctgcagagcagatggtcaatgtggttcttcaagaacgacaaa
gccaaatcatggacagagaaccttagaaccgtcacagccttcgatacagtcgaagatttc
tgggcactatataatcacatacaagttgccagcagaataacatcaggatgtgactactca
ttattcaaggagggtgtaaaacccatgtgggaagacgacaagaacaaagatggtggcaga
tggctcatagggttcgaccgcaaatcaaaaccacaagacatagacagatgttggttagaa
acgatgttgctaatggttggagagagctttgacgacgattcagatctagtcaacggtgca
gtggtcaacattaggagtaaaggaaacaagattgcaatgtggacgggagattggaggaaa
gaagactcgataaccaatataggacgaaaattcaaagaaaggttaggtctaccagcgaaa
tactcaataggttatgaggcacataaagacacaatgacgaagacggggtccatggcaaag
agtctctacaccgtatga

DBGET integrated database retrieval system