KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100887922Help
Entry
100887922         CDS       T01019                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100887922
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100887922
   04070 Phosphatidylinositol signaling system
    100887922
   04150 mTOR signaling pathway
    100887922
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100887922
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100887922
Membrane trafficking [BR:spu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100887922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MASKDLTPELIIARVISKRTEDMDITNHQRKKCIEEYKTTYVLKVCGCEEYLLDDNYPVS
QYKYIRQCILKSKIPELMLMSKDTVLNSLPDVHLLLPSYMRRASTMPSDRTTSCVWEVEE
NLRVKINFATYVNVKELDKIYVRTGIYHGEEPLCPIVSTEQVPWSNPRWNEWLTYDIKVN
DIPRSARWCVSICSSEKRKGKKEGGFAIAWGNINLFDFTNRLQMGNMRLYLWPPPKGNDD
LLNPFGQTGPNPNKDAPCLELEFYRYPHSLLFPCYSQIQQFAFFVTKAQRREEINGEKPP
TEEELVLLEEILNRDRLHEMSVQEKELVWKLRLVCREYPYSLPKLLSSVKWYSREDVSQL
YVLLKDWPDMDAETALGLLDCSYADLGVRTEAVNCLDRMSDEQVTQYLLQLVQVLKYESY
LDNPLARFLLKRSLYNQRIGHFFFWHLRSEMHKPSVSRRFGLMLEAYCRSLGPYLKLLVR
QVEALDKLSKLTEMLNEKKDDTNRSVVKYLADPYGKPDFHRSSSRETSLVPVNPVLLLGA
SLAGSTSARMSSAKRASEMLEMGEAKEQLPQLGHVRTPEISIRYLRQDMLTLQMIQIMDS
IWQQHGLDLKMTPYRCLATGNMTGLIEVVRNSSNIYDIQHKAGIMSTLQLKSGVIHQWIK
EKCKGSQYDAAVDTFTKSCAGYCVATFILGIGDRHSSNIMVSQQGQIFHIDFGHFLGHVK
KKYGIKRERVPFVLTEDFLKVITKGNDVSKSLEFKKFQELCCQAYLILRDHSNLFISLFT
LMLGTEIPELQSIDDVGYLHKTLAVGKTETEALEYFLKQLNDAHGGGWTTKMDWLCHALK
HGI
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaagacctcactccagaactcatcattgccagagtgatctccaaaagaaca
gaggacatggatatcaccaatcatcaacggaaaaagtgcatagaggagtacaagactacc
tatgtcctgaaggtgtgcgggtgtgaggagtacctgcttgatgataactatccagtgtca
cagtacaagtatatccggcagtgcatcctgaagagcaagattccagagctgatgctgatg
tccaaagacaccgtcctgaacagtctcccggatgtccatctcctcctaccgtcctacatg
agacgggcttccaccatgccttccgaccggaccacctcctgcgtctgggaagtagaggag
aacctgagagtcaagattaactttgccacctacgtcaacgtcaaggaactagacaaaata
tacgtccgaacaggcatctaccacggggaagagcctctgtgccccatcgtgtctacggag
caggtcccgtggtcaaaccctcgctggaacgagtggttgacctatgacatcaaggtcaat
gacattcctcggagcgctaggtggtgcgtctcgatatgctcatcggagaagaggaaagga
aagaaagagggtggctttgcaatagcctggggcaacatcaacctctttgacttcaccaac
cggctccagatgggcaacatgcgcctctacctctggcccccgcccaagggcaacgatgac
ctcctcaaccccttcggccagaccggaccaaaccccaacaaggacgccccgtgcctggag
ctggaattctaccgctaccctcacagcctgctcttcccgtgctactcccagatccagcag
tttgcctttttcgtgaccaaggcgcagaggagggaagagataaacggggaaaaacctcct
acggaagaggagctcgtgctgctggaggaaatcttgaacagggacagactacatgagatg
tctgtgcaggagaaagaacttgtctggaaactcagacttgtatgcagagaatatccatac
tcactacccaagctgctcagctctgtcaagtggtacagcagagaggatgtatcacagctg
tacgttctcttgaaagactggccagacatggacgccgagactgctctaggtctcctagac
tgtagctatgctgatctgggcgtcaggacagaagcggtcaactgcctggatcgcatgtcg
gatgaacaggtcacacaatacttgcttcaacttgtacaggttttgaagtatgagtcctac
ctagacaaccctcttgccaggtttcttctcaaacgatctctgtacaaccaaaggattgga
catttcttcttctggcatctgagatctgagatgcacaagccaagcgttagcagacgtttt
ggtctgatgcttgaagcgtactgccggtcactcggtccatacctcaagctgctggtcaga
caggtcgaggctctggacaaactctccaagctcactgaaatgctcaatgagaagaaagat
gacacaaacaggagcgttgttaaataccttgcagatccatatggcaagccggactttcat
cgaagctcttccagggagacttcccttgtccccgtcaaccccgtccttctccttggggca
agcctcgcagggtcgacaagtgcaagaatgtcgtctgcaaagcgcgcctctgagatgcta
gaaatgggagaagccaaagagcaattgccccagttgggtcatgtgcgaacgccggagatc
tcaataagatatctgaggcaagacatgttaacccttcagatgattcagatcatggattca
atatggcagcagcatggactagacctcaagatgacaccttaccgttgcctggcaaccggg
aacatgaccggtctgatcgaggtcgtgaggaactcttcaaacatctatgacatacagcac
aaggctggtattatgagcaccctacagctcaagagtggtgtcatccatcaatggatcaag
gaaaagtgcaaaggatcgcaatacgatgctgcagtcgataccttcaccaagtcgtgtgca
ggatactgtgtagctacattcatcttgggtatcggagacagacatagtagtaacatcatg
gtctcacagcagggacagatcttccacatagactttggccatttccttggtcacgtcaag
aagaagtacggcatcaagcgagagagggtgcccttcgttcttacagaagacttcctcaag
gtcatcaccaagggcaacgatgtatccaagagtctagagttcaaaaaattccaggagctt
tgttgccaggcctacctgatcctgcgagaccactccaacctcttcatcagcctctttacc
ctcatgctgggcacggagatccccgaactccaatccatcgatgatgtcggctacctccac
aagacgcttgccgtcggtaagaccgagaccgaggccctggagtatttccttaagcaactg
aacgatgctcacggcggaggttggactaccaaaatggactggctttgccatgcactcaaa
catggaatatga

DBGET integrated database retrieval system