KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100888004Help
Entry
100888004         CDS       T01019                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100888004
   04150 mTOR signaling pathway
    100888004
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100888004
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100888004
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100888004
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100888004
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100888004
  Mitophagy factors
   Other mitophagy factors
    100888004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 550 aa AA seqDB search
MTTINSGVKIGHYVLGETIGMGTFGKVKMGEHLLTQHKVAIKILNRQKIKNLDVVSKIKR
EIQNMKLFRHPHIVKLYQVISTPTDIFMVMEYVAGGELFDYIVKHGKVGSMKQGRFFQQI
ISGVDLCHRHNDRSPDLKSQKSLPYFDPTSCQVIADFGLSNMMTDGEFLRTSCGSPNYAA
PEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKGGHFTIPDHIERSQ
VKSLIQHMLQVDPLKRATIKDIREHDWFRIDMPQYLFPQNDFDDSIVDVDAVKEVCEKFN
VREGEVQNALMCGDPHDQLRIAYYLIIDNKRIMDEASKTQMKDFYLASSPPPRESYLEVQ
SNLLXPTPVXKDHTFSVIYPFSFSLVAMTMNTLENFNNQSSESQRRVSATPVKRSKWHLG
IRSQSRPHDIMGEVFRAMKALNFEWKVVNPFYVRVRRTNPLTGAQIKLGLQLYQVDSKSY
LLDFKSLTNPRDSGMTNFGSDDRMEVEEPMSPRSPTTPTLPQSPGSPRCMQHCTMEFFEM
CASLIATLAR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccataaattcaggagtcaaaattggacactatgtcctcggtgaaacaatcggg
atggggacatttggcaaagtaaaaatgggtgaacatctattgacccagcacaaggtagcc
atcaagattcttaacagacagaagatcaagaacttggacgtggtcagtaagatcaaacga
gagattcaaaatatgaaactcttccgtcatcctcatattgtcaaattgtatcaggttatc
agtacacccacagatatcttcatggtgatggaatatgtggcaggcggagaactctttgat
tatatcgtcaaacatggaaaggtgggatcaatgaagcaaggacggttctttcagcagatt
atttccggtgtggacctctgccatcgtcacaatgatcgttcacctgacctcaagtcccag
aaaagccttccctactttgacccaacttcatgtcaagtgatcgccgactttggtctgtct
aacatgatgaccgacggagagttcttacggacaagctgtgggtcacccaactatgccgca
ccggaggtcatatctggcaagctttatgcaggacccgaggtggatatctggagctgcgga
gtgatcctttacgccctcctgtgtggcacgctacccttcgatgatgaacatgttcccacg
ctcttcagaaaaatcaaaggcggtcatttcacaatcccagaccatatagagcgttcccag
gtcaagagtttgattcagcatatgttacaggtagacccactcaagagagcaactattaag
gatatcagagagcacgactggttcaggattgatatgccacagtacctctttcctcagaat
gattttgatgattctatcgtagatgtggacgctgtcaaagaagtctgtgagaaattcaac
gtgagagaaggtgaagtccagaacgcattaatgtgcggtgatcctcatgatcagctgcgg
attgcttactatctcatcatcgacaacaagaggatcatggacgaagcttctaagacccaa
atgaaggatttctaccttgcctcaagcccgccaccgagggagtcctatctggaagtccaa
tcaaacctgctttagccaacacctgtatagaaggaccacactttttctgtcatttaccct
ttttctttttcgcttgtagctatgacgatgaacacgctagagaacttcaacaaccagagc
tccgagagccagcgacgagtgtcggcgacgcccgtcaagaggtcaaagtggcacctgggt
atcaggtcacagagcaggccgcatgacatcatgggagaggtcttcagggccatgaaagca
ctcaattttgaatggaaggtagtgaatccgttctacgtgagggtcagacgaaccaacccg
ctgaccggtgctcagatcaagttgggtcttcagctgtaccaggtggacagtaagagttac
ctgctggactttaagagcttgaccaaccccagggacagtggcatgaccaactttggttct
gatgatcgaatggaagtggaggagcccatgtcaccgcgatcaccgaccacgccgaccttg
ccacaatcccccggttcaccccgctgcatgcagcactgcacaatggaattctttgagatg
tgtgctagtctgatcgctacccttgcacgatga

DBGET integrated database retrieval system