KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100888398Help
Entry
100888398         CDS       T01019                                 

Definition
serine/threonine-protein kinase mTOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100888398
Protein kinases [BR:spu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100888398
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 410 aa AA seqDB search
MQKPQWYKQTYEEAEKGFEETGKGEKGLNRDDRAHGALLIINELIRTSSREGERLRQEME
EVSQQQTQHEHSFRDLGSSSNKAKSPTGPQLGHNQYVQRALASPLSLVATGIQPKPRITE
SRYCLELMQENFDIVCQQVLKFCGSRNPLIQQILLNLLPRLAAFEPKMFVTSYLEDTVKY
MLISLRRERERSNAFQAVGLLAVAVKGNITEHLGKILEIVRSSLPHKDIPHRKHKSIIVD
PAVFTCISMLARAVGPVIARDVKELLEPMLAVGLSPALTAALHDLAKQIPQLKKDIQDGL
LKMLSLVLMHKPLRHPGTPRALLSPTGQTGTALSSIDSGDLTSTVLALRTLGNFDFEGHS
LTQFVRHCADHFLSSEHKEIRIEAARTCSSLLQPAVNVSFHGVIVHYVVF
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaccccagtggtataagcaaacctatgaggaagccgagaagggctttgaagag
acggggaaaggagagaagggtttgaaccgagatgacagagcccatggagcattactcatc
atcaatgaactcatcagaactagtagcagagaaggcgagcgtcttcgtcaggaaatggag
gaggtatcgcaacagcagacacagcatgagcatagctttagggacctcggatcatccagc
aacaaagctaaatcacccacaggcccccagctaggacacaaccagtacgttcagcgagcc
ctagccagtccactctctctggttgccaccggtatccaacccaaaccacgcatcacagag
agtcgctactgtctggaactcatgcaggaaaatttcgacattgtttgtcagcaagtgttg
aagttttgtgggagtcgcaatcctctgatccagcagattctcctcaacctcctacccagg
ctggctgcatttgagccaaagatgtttgttacttcgtaccttgaagatacagtcaaatac
atgcttatctctctcagaagggagagagaacgctccaatgcattccaagccgttggtctt
ctagcagtggctgtcaaaggaaacatcacggagcacttgggcaagatcttagagattgtc
cgctcatccttgcctcataaggacatcccgcacaggaaacacaagagcatcattgtggat
ccagcggtcttcacctgtatcagcatgttagccagagcagtaggaccggtcattgccaga
gatgtcaaggaactattggaacccatgctggctgttggtctgagcccggccttgactgca
gcccttcacgaccttgccaagcagattccccagctcaagaaggatatccaagatggcctc
ctcaagatgctgtccctggtcctcatgcacaaacccctgcgccatcccgggacaccgagg
gcgctgctctctcctactggccagacaggtacagcattgtcatccattgactccggtgac
ctcaccagcacagtgcttgccctcaggaccttgggtaactttgactttgaaggtcactcc
ctcacccagtttgtgcgtcattgcgccgaccacttcttgtccagtgagcacaaggagatc
cgcattgaggcggctagaacctgttccagcctgctccaaccggctgtcaatgtaagtttt
catggagtgattgtacattacgttgtattctga

DBGET integrated database retrieval system