KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100888650Help
Entry
100888650         CDS       T01019                                 

Definition
profilin-4-like
Orthology
K05759  
profilin
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Exosome [BR:spu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100888650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 128 aa AA seqDB search
MNQLQNLLHDALIATGHVENCAIVRRKDISLRASSAGFTLSGDEMQKLIDAFKDPPRTRQ
EGLYFHDKLYKCVRADKNSIYAKCDKVGMVLVKTATLVIMGTYSDNMYSSVCVEAIEKLA
SYFIEKSK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcttcagaatctccttcatgatgctctgatagcaacgggtcatgtagagaac
tgtgctatcgtcaggaggaaagatatctcactcagagcaagctcagctggatttacgctc
tctggtgatgagatgcagaagctgatagatgccttcaaagaccctcctagaaccagacaa
gaagggctctacttccatgataaactctacaagtgtgtcagagcagacaagaactccatc
tatgctaaatgtgacaaggttggtatggtgctagtcaagactgccactctagtcatcatg
ggcacatattcagataacatgtactcaagtgtgtgtgtagaagccattgaaaagctagca
tcctacttcatagagaagagcaaatga

DBGET integrated database retrieval system