KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100888919Help
Entry
100888919         CDS       T01019                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100888919
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100888919
   04070 Phosphatidylinositol signaling system
    100888919
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100888919
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100888919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1638 aa AA seqDB search
MAGADTSKVRLKLEEIVVPDDLVEGNKFLKWDEDSSSAIPVTLKVDAHGHFLYWKIQNKE
GSSSKLDVECLELTQLRDTRTGKYAMTPKDAKLSVLCDMGSKDVPLEDKTLTVVYGSEIV
SLNFTNFCGTSEKVAQQWCETLLKLAHNRSAQNPSPGKLLHKMYTKIIIMVNRDGHIPVK
NIRKMFASSNSDRKKVETALQVAGVHSGKDDTIDPKKFTYDVFFTFYLRLVNQKEVDRLF
QEMGARNKPYLQTAQLVKFLNNEQRDPRLNEILYPFYDAKTAISILERFEKNKQFAKKGN
MSIEGLIRYLISDDNQVDGLESYLIAQDMEQPLAHYFIKSSHNTYLTGHQLTGKSTVEIY
RQVLLSGCRCVELDCWDGKGDTDPEPVITHGYTMCTDVLFKDVIEAINETAFKTSEYPVI
LSFENHCNQKQQAKMAHYCRTIFGDKLLIDPLPEFPLEAGKPQPCPAALKNKILVKNKKR
KHTDASKKRAGKRRFSSTSSFTSSFDADESTETPPSTMRRGRRLQSTTSLTSMDSGDAPS
GDSSRPTRSASRRGSKRKMLLQISEVTYDETIIPDDSGKGVKTIEETAETPEQNGEGSVI
KEGVSPSTPEDKPKTSRTEGKPGSKVSSTPKLKSGGSKDEIVPPVSERKTSKGDVTVKSD
DVKQRRKLSRQEAQDEDTDTSKPPPPRVKRKMSKQESEEKSGDVEMNGENGDAGNDSKLT
DVQEDDDEESDESDDEEALSKEEALKKLQEKKDRGTAGQEAEAGAEMSALVNYVQPVHFS
TFEGSDKRNHSYEISSFVETSAMNRVKENPVEFVNYNKRQLSRIYPKGTRVDSSNFMPQI
FWNVGCQLVALNYQNLDLPMQLNLGLFNLNGRTGYILKPDFMRRKDRHFDPFAESTMDGI
VAATVEVKVLSGQFLKKVGTYIEVDMFGLPADTVRKKYKTKTINNTGINPQYEDDGFIFP
KVIMPKLAMLRITAYDDNNKQIGHRILPVESLRPGYRHIPLRNELYQPLLMPSVFVHIKV
KDYVPVGLANFADALVNPIQHQLKMDEQVKIRTEALSILLEEAKLMEESKEAAVEDSPDD
MANTSTPEPQKEETGEGSSSPEQESKPPIDNAAIAEGTPSNKPLEHTKLEMLEKRDSVDA
LPPTMKKVSRPSRQSETQLQILMSQWQPEVVAKDSIGSSTSSGGLLRSVSMGTAQFEANA
FSGFHNQSIRSRSTPNLVPQEEIVAATIDEIKVEKKYVKVKTRLDNELNKLVKKQEKKQS
KLKKGQSKDITKFKMSQEKARRNKEKKLVSMEKKMLKNTTPEEAKQQSAKTMEQLEQEQE
KEMLKKQVSQEDALIGLYRRHYLEEKELKVEHAEMLFELQMDLMAAIHEKQLKKLDGQHK
KVEQELRKMLGSKNIEEMKSIGKMKREKQEISRLKREARKKHIDQAVDERTHLIKLQENK
KKELKDSMKELQQNLSQEEDDMVLVIEEEYKKKTDHLVQDRKFKRLTSDTNGSIKAMDDL
SPSDGGGQNGLNGDMKKSASSGLNGMSDGPSSVSGGGDVPDSNGLNGHSNGNTGSPGHHV
KGHMDTEVEVHASGSLYSEEVNTNNSAQTHSNGDIANGLESSNTMADEEIVCKDLETGER
KVCDSPARVNPVVESTKL
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcggatacatcaaaggttcggctaaagttggaagagattgttgttcctgat
gacctagtggaaggcaacaaattcctcaaatgggacgaggattcttcgtctgcaattcca
gtgactctgaaggttgacgctcatggacactttctctattggaagatccagaataaggag
ggatccagtagtaaattggatgtggagtgcctggaactgacccaattgcgagacacaaga
acaggaaaatatgctatgacaccaaaggatgccaagctcagcgttctgtgtgacatgggt
tccaaggatgttcctctagaagataagacactcacagtggtctatggatcagagattgtt
agtctcaatttcacaaacttctgtgggacatcagagaaagtcgctcagcaatggtgtgaa
actttgctcaaactagcccacaacagatccgctcagaacccttcaccaggcaagctactc
cacaaaatgtacaccaagataatcatcatggttaacagagatggccacattccagtcaaa
aacatccgtaagatgtttgcgtcaagtaattcagaccggaagaaagttgagaccgcttta
caggtggcaggggttcatagtggcaaggatgacacaatcgaccctaagaagttcacatat
gatgttttcttcacattctaccttcgcttagtcaaccaaaaagaagtggacagattattc
caagagatgggagcgaggaacaagccctatttgcagacagcccaactggtaaagttcctg
aacaatgaacagcgtgaccctcgtcttaatgagatcctttatccattctatgatgccaag
acagctataagtatcctggagaggtttgagaagaacaaacagtttgccaagaaaggtaac
atgtcaatagagggattgattcgttatctaatcagtgatgataaccaggtggatggtctg
gagtcttatcttattgctcaagatatggagcaaccattggctcattacttcatcaaatca
tctcacaacacatacctcacaggtcatcagttgacagggaagtcgaccgttgagatctat
cgtcaggtgttactatcaggatgtcgctgtgtagagctggattgctgggatggtaaaggt
gatacagaccctgaaccggttattactcacggttacaccatgtgtactgatgtactcttc
aaggatgtgatagaagccattaatgaaacagccttcaagacgtcggagtaccctgttatc
ctttcctttgagaatcactgcaatcaaaagcagcaggccaagatggctcattattgcaga
acaatctttggagacaagcttctcattgatccactcccagagtttcctttggaagcgggg
aagccgcagccctgcccggcagctctcaagaataagatcctggtgaagaacaagaaacgc
aagcacacagatgcaagcaagaaacgagcaggaaagcgtcgatttagctccacctcctct
ttcaccagttcgtttgatgctgatgaatcgacggagacgccgccctctacgatgagacga
ggtcgacgccttcagagcactacatcattgacctccatggatagcggggatgctccttct
ggtgatagtagtaggcctactcggtcagcctctcgaagaggtagcaagcgtaaaatgctc
ctacagatctcagaagtgacttatgatgagactattatcccagacgactcaggaaaggga
gtgaagacaattgaggagacggctgagacaccagaacaaaatggagaaggcagtgtaata
aaagagggtgtgtcaccgtctacacctgaagataaacccaaaacatcaagaacagaagga
aaaccaggtagcaaagtttcatccacccccaaactaaaatcaggaggcagcaaggatgaa
attgttccccctgtctctgaaaggaagacatcgaaaggagatgtcacagtgaaaagtgat
gatgtaaagcagagaagaaaattatctcgacaggaggcacaagatgaagatacagataca
agtaaaccaccccctccacgtgtaaagagaaaaatgtcaaaacaggaaagcgaagagaaa
agtggagatgttgaaatgaacggtgaaaatggggatgcaggcaatgattccaagctgacg
gatgtccaagaggacgacgatgaggagagtgatgaaagcgacgatgaggaagctctcagt
aaggaagaagcgctcaaaaagctgcaggaaaagaaagacaggggtacagctggtcaagaa
gcagaggccggagctgagatgtcagccttggtcaattacgtccagccggtccatttctca
acttttgaagggtcagacaagagaaaccacagctatgagatctcatcatttgtggaaact
tcagccatgaacagagtcaaggaaaatccagtggaatttgtcaactacaacaagagacaa
ttgtctaggatctaccctaaaggaaccagagtagactcaagtaacttcatgcctcagatc
ttttggaatgttggttgccagttggttgctctcaactaccaaaatcttgatctaccaatg
caactgaatcttggtctgttcaatctgaatggtagaacaggatatattcttaaacctgac
ttcatgcgaagaaaggaccgccattttgatcccttcgctgagtccaccatggatggcatt
gtagctgctaccgtagaggtcaaggtgctatctggccagttcttgaagaaggttggaaca
tacattgaggtggacatgtttggtctaccagcagacacagtaaggaagaagtataagact
aagactatcaacaatactggtatcaaccctcagtatgaagatgatggcttcatctttccc
aaggttatcatgcctaaactagctatgttaagaatcactgcatatgacgataacaacaaa
cagattggacatcgtattctaccagtagaatcactcagaccagggtatcgtcacatccct
ctgcgcaatgagctctaccagcctctcctcatgccatcagtctttgtccacatcaaggtc
aaagactacgtgcccgttggtctggcaaactttgcagatgctctggtcaatcctatccag
catcagctcaagatggatgaacaggtcaagatcaggacagaagctctctcaattctcttg
gaagaagccaaattgatggaggaatcgaaagaagctgcagtagaggacagtcccgatgat
atggctaacacctccacaccggagcctcaaaaagaagagaccggtgagggatcaagttca
cctgagcaggagagtaaacctccaatagataatgctgccatagctgaggggacgcctagt
aacaaaccactggaacatactaagctggaaatgctagagaagagggacagcgttgatgcg
ttgcccccgacgatgaagaaagtatccaggccatccagacagtcagaaactcaacttcag
atcttaatgagccaatggcaaccagaggttgtggctaaagacagcattggaagtagcacc
agcagcggagggttgctaaggtccgtttccatgggaacggctcagttcgaggctaatgct
ttctcaggatttcacaaccaaagcatccgaagccgcagcactcccaacctggtcccacaa
gaggagatagttgctgccaccattgatgagattaaagtagagaagaaatatgtgaaggtg
aagacacggctggacaatgagctcaataagctggtgaagaaacaagagaaaaaacagagt
aaactcaagaagggtcagtccaaggacatcactaaattcaagatgtctcaagagaaagcg
aggaggaataaagagaagaagctggtttccatggagaagaagatgctcaagaacacaact
cctgaagaagccaaacagcaaagtgccaaaactatggagcagttagagcaagaacaagaa
aaagagatgctgaagaagcaagtgagccaggaggatgccttgataggtctgtatagacgt
cactacctggaggagaaggagctgaaggtggagcatgcagagatgctctttgagcttcag
atggatctcatggcagctatacatgaaaaacaactcaagaaactagatggtcagcacaag
aaggttgagcaggagcttcgtaagatgcttggtagtaagaacatcgaggagatgaagagt
attggtaagatgaagagagagaaacaagagatcagtcgactgaagagagaagctcgtaag
aaacacattgatcaagctgtcgatgagagaacacatttgatcaaattgcaggagaacaag
aagaaagagctgaaggatagcatgaaagaactacaacaaaacctctcccaagaagaagat
gatatggtattggtgattgaggaggaatacaagaagaagaccgaccatctggttcaagac
aggaagttcaagcgattgacctctgacaccaatggttctatcaaagccatggatgatttg
tccccatccgatggaggaggtcagaatggtcttaatggtgacatgaagaaatcagctagt
agtggtctgaatggcatgtcagatggtcctagctcagtgagtggtggtggtgatgtccca
gacagtaacggattgaacggacacagcaacgggaacacgggtagccctggacaccatgtc
aaaggtcatatggatactgaagtagaagtgcatgccagtgggagcctttactcagaggag
gtcaatacaaacaactctgctcaaacccattccaatggtgacattgccaatggacttgaa
agcagcaatactatggcagatgaagagatagtatgtaaggacttggaaacaggtgaaaga
aaagtctgtgatagtccagcccgggtcaaccctgtcgtggagtccaccaaactctaa

DBGET integrated database retrieval system