KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889197Help
Entry
100889197         CDS       T01019                                 

Definition
cAMP-responsive element modulator-like
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100889197
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100889197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 240 aa AA seqDB search
MDVGEDGKAQEENGGQLDEDSLTVDGEVERKKRQEILSRRPSYRRILNDLSSDVPGVPKI
EEEPPGSDESEGTQSIIVSGGTAIQNLPTGAATIQIANPGLDGVQGIQTLTMTSAGGSGI
VQSIQTQDGQQFFVPASTAVNIARLGEVQAYQIRPATSLPQGVVMAAPSGLQQQHVMVEE
AGRKRELRLMKNREAAKECRRKKKEYIKCLENRVAVLENQNKTLIEELKSLKELYCHKSD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcggggaggacggcaaagcacaagaggagaacggcggacagttggatgaagac
agtctgactgtggatggtgaggttgagagaaagaaaagacaagaaatattgtcacgaaga
ccttcctacaggagaatcttgaatgacctgtcgtcagacgtaccaggtgtgcccaagata
gaggaagagccaccaggaagtgatgagtcggaaggcacgcagagtatcatcgtttcagga
ggaacagccatacaaaacctaccaacaggggcagccaccatccagattgccaaccctgga
ctagatggtgtccaaggcattcagacgctgaccatgaccagtgctggagggtcaggcatt
gtccagtccatccagacccaagacggtcagcagttctttgtgccagcttcaacggctgtg
aacattgcccgtcttggagaggtacaagcctaccagatcagaccggccacatcgttaccc
cagggcgtggtcatggcggcaccatcgggcctccaacagcagcatgtcatggtagaagaa
gctggaaggaaacgagaactcagactcatgaagaacagggaagcagccaaagagtgccgg
cggaagaagaaggaatacatcaagtgtcttgagaacagagtggcagtcttagagaaccag
aacaagacattaatagaggaactcaagtcactcaaagagttatactgtcacaaatctgat
taa

DBGET integrated database retrieval system