KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889197Help
Entry
100889197         CDS       T01019                                 

Definition
(RefSeq) cAMP-responsive element modulator
  KO
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100889197
Transcription factors [BR:spu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    100889197
Mitochondrial biogenesis [BR:spu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100889197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 294 aa AA seqDB search
MDVGEDGKAQEENGGQVNNISPMPVSLLMTPPNNTTPLNQVVHVQSVIQTNNQHSVIQAT
PVVQVQQLDEDSLTVDGEVERKKRQEILSRRPSYRRILNDLSSDVPGVPKIEEEPPGSDE
SEGTQSIIVSGGTAIQNLPTGAATIQIANPGLDGVQGIQTLTMTSAGGSGIVQSIQTQDG
QQFFVPASTGEYPVNIARLGEVQAYQIRPATSLPQGVVMAAPSGLQQQHVMVEEAGRKRE
LRLMKNREAAKECRRKKKEYIKCLENRVAVLENQNKTLIEELKSLKELYCHKSD
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcggggaggacggcaaagcacaagaggagaacggcggacaggtgaacaacatc
tcacctatgccggtttccttgttgatgactccgcccaacaacaccacgcccctcaatcaa
gtggttcacgtccagtctgtcattcaaactaacaaccagcactccgtcattcaggctact
cctgtagttcaagttcagcagttggatgaagacagtctgactgtggatggtgaggttgag
agaaagaaaagacaagaaatattgtcacgaagaccttcctacaggagaatcttgaatgac
ctgtcgtcagacgtaccaggtgtgcccaagatagaggaagagccaccaggaagtgatgag
tcggaaggcacgcagagtatcatcgtttcaggaggaacagccatacaaaacctaccaaca
ggggcagccaccatccagattgccaaccctggactagatggtgtccaaggcattcagacg
ctgaccatgaccagtgctggagggtcaggcattgtccagtccatccagacccaagacggt
cagcagttctttgtgccagcttcaacgggtgagtaccctgtgaacattgcccgtcttgga
gaggtacaagcctaccagatcagaccggccacatcgttaccccagggcgtggtcatggcg
gcaccatcgggcctccaacagcagcatgtcatggtagaagaagctggaaggaaacgagaa
ctcagactcatgaagaacagggaagcagccaaagagtgccggcggaagaagaaggaatac
atcaagtgtcttgagaacagagtggcagtcttagagaaccagaacaagacattaatagag
gaactcaagtcactcaaagagttatactgtcacaaatctgattaa

DBGET integrated database retrieval system