KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889277Help
Entry
100889277         CDS       T01019                                 

Definition
DNA polymerase delta subunit 4-like
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:spu03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:spu03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:spu03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:spu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:spu03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 81 aa AA seqDB search
MAAHRILFESAEDLIRKKHLQTLREFDLNWRYGPCTGITRLERWERAESHDQNPSPQIKD
LILEHEDDEDYVQNTWSSYPL
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccatcgcatcctgtttgagagtgcagaggatttgattaggaagaagcatctc
caaacacttagagaatttgatctgaattggagatatgggccttgcaccggaatcactcgt
ttagagaggtgggagagagcagagagccatgatcagaatccttcacctcaaatcaaagat
ctcatcttagaacatgaagatgatgaggattatgtccaaaacacctggtcttcttaccct
ctatga

DBGET integrated database retrieval system