KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889551Help
Entry
100889551         CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100889551
Peptidases [BR:spu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100889551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 125 aa AA seqDB search
MCRRCSLIHADDTLKSFYEQTKDMTPEERGKKLECNESISHAHGESAQEGQTEAPQAEED
VCPHFIALVEKDGCVYELDGNKKFPINHGPIQEGFLKSAAKVCKMFMDRDPDEVHFTIMA
LSRDS
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagacgttgttccttgatacatgcagatgatacattgaagtcattctacgagcag
accaaagacatgaccccggaggagagaggaaagaaactagaatgcaatgaaagcatcagt
catgctcatggagagagtgctcaggagggccaaactgaggcacctcaagcagaggaggat
gtgtgtccacatttcatagctttggtggagaaggatggttgcgtctatgagctagatggt
aacaagaagttccctattaaccatggacccatccaggaaggcttcctcaagtcggctgcc
aaagtgtgtaagatgttcatggaccgagaccctgatgaagtccatttcaccatcatggct
ctatcccgcgactcctag

DBGET integrated database retrieval system