KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889886Help
Entry
100889886         CDS       T01019                                 

Definition
ubiquitin carboxyl-terminal hydrolase 25-like
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1100 aa AA seqDB search
MTVEQNAIRNQQLIKNQETALNQLKEITGVQDLAALRHAYEASNGDITQAITFLTEGHEA
TTAAAGAGAAGAAGAAQGNPRHHAAHQPVAVATAATAAAQPANAPASVHGPRNRPQGEDG
KSGDVIDLTQDRDEKEDLQRAIALSLQETTQASIGVSAEEQDISRVLEQSIRDAGQGRSN
TWFVDPLNPHDRQRESGWPVGLKNVGNTCWFSAVIQMGALDDQILNNFLFFATHTLSLSF
SLLVSLSLSSSTQVHRNLLFMSELRSLFALMLGTRRKYVDPSKSVQILKAAFSGGGADNQ
QDVSEFTHKLLEWLEDAFILDTSGHPSQDEGADGGSNVAKNPMLDLFYGQYKAEGINEGK
VFSNLETFGQCPLQINGYHDLHQSLEASMSKAEIETVNGDATYLSAQEHWFTRLPHVLIF
ELSRFQFNQELGRPEKIHNQFKFPATLYMDRYMDANREIVRKKREEVAVLRQQYSELQSR
LERFLCYGSGAKRMPLHDVLQYTLEYANSGCPERRHLDGMGSPPQGICNNTSVCEDVEMA
SPCGSASNSPRPGSSPNLQPMEQPFAPPSPTSLSLSTSPTVSSKLPRYQKPPPLNLLDKP
PLGHGAGGGTAVHGGAGGSGGLGAGVGPAIKGELPSPKPGHITDTELNILQGCLKRWRTE
VMSEVTDLHQEIAKVDEKIHTTYEEVELKYHKYRLHAVLVHEGQALAGHYWSYILNHKRN
VWIKFNDIAVTEVTFEELERVSLGGDGNASAYCVMYVESGNRALFEEVHAETGLINLEDL
GNDLGQLIVDDNQKFEEELKQWDEQVQQRRQQQLQLQLKQQGERGQADGGARERVTSRGA
STTNEEVIAVDDVPMKDEDEAMSPRRVPPLANQDSMETSHTETRPKTPKSPRTPKSPVSA
APFFGEGGPEAAVQQSPVSAAPFFGEGGPEAAVQYQEALPYFVHACKLNETFDPPDTSKR
MDSKLLEYFRRHCLIQLNEQCATTFDAGEEQEASTSLQVMSELVVPCTSLLGSNPGDDAQ
AVEEIRGRWCSYLGHDLPGKLQDKLQDLLSRLLDGSSDGLTVKTPPLIRAQRTVNHSQQF
RKSMQLIKSFEEAGQGEDSS
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcgaacaaaatgcaattcgaaatcagcagcttataaagaatcaggagaccgcc
ctcaaccagctgaaggagatcaccggagtccaggacctggccgctctgaggcacgcctac
gaggccagcaacggcgacatcacccaggccatcaccttcctgaccgagggccacgaggcc
accacagcagcagccggagcaggggcagcaggagcagcgggggcggcccaggggaaccca
aggcaccatgctgcccaccaaccagtggcagtcgcgactgcagcaactgcagcagcacag
ccagccaatgctccggccagcgtgcatggtccaagaaacaggcctcaaggagaggacggt
aagtcgggtgatgtgatcgacctgactcaggatcgagacgagaaagaggacctacaaaga
gccatagcactcagcctgcaggagaccacacaggccagcatcggagtatcggcagaggag
caagatatcagcagggtcctagagcagagtatccgtgatgcagggcaaggcaggagtaac
acatggtttgtcgaccctctaaacccccatgatcggcagagggaaagcggctggccagta
gggctaaagaatgtgggcaatacgtgctggttctctgctgttatacagatgggtgcatta
gacgatcaaattttaaataattttctgttctttgctacccacaccctctctctttcattc
tccctccttgtttctctttcactctcatcctccacacaggtgcataggaatctcttgttc
atgtcagagctccggtctctcttcgctctcatgctgggtaccaggagaaagtacgttgac
ccttccaagtccgtccagattctcaaggcagctttcagcggtgggggtgctgacaaccaa
caggatgtcagtgaattcacacacaagctccttgaatggttagaagatgccttcatatta
gacacatctgggcatccctcacaagatgaaggcgctgacggaggatcaaacgtagccaag
aaccccatgctcgatctcttttacggccagtacaaagcagagggcatcaacgagggcaaa
gtattcagcaatctcgagacgtttggacagtgccctctccagatcaacggctaccacgat
ctccatcagagcctggaagcttccatgtccaaggcggagattgagacggtcaatggagat
gcgacttatctgtctgcacaagagcactggtttactaggttaccccatgttctcatcttc
gagctttcaagatttcagttcaaccaggagcttggaaggcctgagaagatacacaaccaa
ttcaaattccccgcaacactttatatggatagatatatggatgctaacagagagattgta
agaaaaaagcgtgaagaagttgcagtgctgcgacagcagtatagtgaactgcaatctaga
ctagaaagatttttatgctacggatctggtgctaagcggatgcctttacacgacgtcctc
caatacacgttagaatatgcaaacagcgggtgccctgaacggaggcatctcgacgggatg
gggagtccccctcaaggaatctgcaataacacctccgtctgcgaggacgtggagatggcg
tcgccttgtggatcagctagtaacagtcctagacctggctcatcgccaaacctccaaccc
atggagcagccgtttgcgccgccaagccccacctccctctccctctccacatcaccaaca
gtgtcttccaagctaccgaggtaccagaaaccgcctccgctcaaccttctggacaagccc
ccactaggtcacggcgccggtggtggtaccgcagttcacggcggcgctgggggttccggt
ggcctgggtgccggtgtggggcctgcaataaagggcgaactgccctctcccaaacctgga
cacatcacagacacagagctaaatatcttacaagggtgcttgaagaggtggaggacagag
gtcatgagtgaggtcacagacttacaccaagagattgccaaagtagatgaaaagattcac
acgacgtatgaagaagtggaactcaaatatcacaagtaccgccttcatgccgtcctggtc
catgaaggtcaagccttagccggtcactactggtcctacatccttaaccacaaaaggaac
gtatggatcaagttcaacgacatcgctgttaccgaggttacgtttgaggagctagagaga
gtgtcgttaggaggggacggtaatgctagtgcctattgcgtcatgtatgtggagtcgggc
aacagagcactgtttgaagaggtccatgcagaaacgggtctcattaacctagaggatctg
ggaaacgacctcggacagctcatcgtcgacgacaaccagaagtttgaggaggagctgaag
cagtgggacgagcaggtacagcaacgccgacagcaacaactgcaacttcagctgaaacag
cagggagaaagagggcaggccgatggtggggccagagagagggtcacatcaaggggagca
agcaccactaacgaggaggtcatcgccgtagatgatgttcctatgaaggacgaggacgaa
gccatgtcacccagacgagtgccaccgcttgccaaccaggacagtatggagacaagtcat
actgagacgaggcccaagacaccaaagagtcctagaactcccaagagcccggtctccgct
gcacctttctttggtgaaggaggtccagaggctgccgttcagcagagcccggtctccgct
gcaccattctttggtgaaggaggtccagaggctgctgtgcagtatcaagaagccttaccc
tactttgtccatgcctgtaagctcaacgaaacatttgatccgccagacaccagcaagaga
atggacagcaagctactagaatacttcaggagacattgtttaatacaactcaacgagcag
tgcgccacaacctttgacgccggcgaagaacaggaagccagcactagcctgcaggtgatg
agcgagctggttgtaccctgcacaagtctgctgggatccaaccccggcgacgatgcgcag
gctgtggaggagatcagggggagatggtgctcgtatcttggacatgacctacctggtaaa
ctgcaggacaagctccaagacctcttgtcgcggctcctggacggctcctcggacggtctg
acggtcaaaaccccgcccctcatccgcgcccaacgaacggtcaaccacagtcagcagttt
agaaaaagcatgcaactcatcaagagctttgaagaagcgggccagggagaagactcatca
tag

DBGET integrated database retrieval system