KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100890677Help
Entry
100890677         CDS       T01019                                 

Definition
insulin receptor substrate 1-like
Orthology
K16172  
insulin receptor substrate 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100890677
   04150 mTOR signaling pathway
    100890677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 404 aa AA seqDB search
MSSQKENVPIPCGVELSIGDIEKSGYLRKLKTMRKKYFVLRSESITGPSRLEYYDNEKKF
RLGGEAKRTVPLSACFNINKKSDAKHKHAIALYTRDDCFSLVADDEESKQEWLRVLLEQQ
RAGGDGKPVPAFEHVWQVTVKPKGLGSSRQLSGIYRLCLTTSTISLVRMNSENEGLEFSL
SAIRRCGHSDCFFFMEVGRQSVTGPGELWMQVEDTVIAQSIHEASLEAMRSVKQQEEMRP
RSHSSTMSSGNPGSDSKSHSASGSRRQSNTLGPSWRTRCDSMPVPNRAMPGSRSGSRSRG
NSEGEDGQSKEEHAIASSSSPVSLLKFGNKLRPRTSSEGEKGMKAPDSPTKTRGRFSIPS
LTSRSSLSSGPIFVMVLDLSILRSVGSIFQKLLPTKKDFMKVKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacagaaggaaaacgtccccattccatgtggagttgaactgtccataggggat
attgagaaatctggttatctgcgcaagcttaagactatgcggaagaagtactttgtgctg
cgctctgagagtatcacaggcccatcacgactcgagtactatgacaacgagaagaagttt
agactgggtggagaagccaaaaggaccgtccctctctctgcctgctttaacatcaacaag
aagtccgacgccaaacacaagcatgccatcgccctctatacgagagacgactgcttttct
ctggttgcggatgatgaggagtcgaagcaggagtggttaagggtgctgttggagcagcag
agggcaggaggagatggcaaacctgtacctgcattcgagcatgtttggcaggtaacggtg
aagcctaaaggtctggggtctagccgccagctgagtggcatctacagactttgtcttacc
acatcaaccatcagcttagtcaggatgaactcagaaaatgaaggattagagttctcattg
tcagccatacgtcgttgcggtcattcagattgtttcttcttcatggaagtcgggcggcag
tcagtgacaggtccaggagaactatggatgcaggttgaagatactgtcattgctcagagc
attcatgaggcatcattagaagccatgcgttccgtgaagcagcaggaagagatgcgccct
cgcagtcacagcagcaccatgagctccgggaacccaggatccgattccaagtcccactcg
gcctcggggagtcgacgtcagtccaacacgctgggaccatcctggaggaccaggtgtgat
agcatgcctgtgccaaaccgtgcgatgccagggtccaggtccgggtccaggtctaggggg
aacagcgagggggaggatgggcagtcaaaggaagagcatgccatagctagtagcagtagc
ccagtcagccttctcaagtttggtaataagctccgcccacggacatctagtgaaggagag
aagggcatgaaagctcccgacagtccgacaaagacgaggggacgattctccattccgtcg
ttgacatccagaagtagtctcagtagtggccccatctttgtaatggttcttgatctctca
attcttagatcagtaggaagcatattccaaaaattacttccaacaaagaaggacttcatg
aaggtgaaggtctga

DBGET integrated database retrieval system